Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   C7M21_RS07980 Genome accession   NZ_CP028207
Coordinates   1570181..1570321 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SRCM102743     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1565181..1575321
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M21_RS07955 (C7M21_01592) - 1565485..1565883 (+) 399 WP_015240486.1 YueI family protein -
  C7M21_RS07960 (C7M21_01593) - 1565980..1566531 (+) 552 WP_003152033.1 cysteine hydrolase family protein -
  C7M21_RS07965 (C7M21_01594) - 1566549..1568015 (+) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  C7M21_RS07970 (C7M21_01595) - 1568145..1569368 (+) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  C7M21_RS07975 (C7M21_01596) - 1569375..1569716 (-) 342 WP_069006914.1 hypothetical protein -
  C7M21_RS07980 (C7M21_01597) degQ 1570181..1570321 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  C7M21_RS07985 (C7M21_01598) - 1570473..1571384 (+) 912 WP_081111611.1 polyprenyl synthetase family protein -
  C7M21_RS07990 (C7M21_01599) comX 1571384..1571548 (+) 165 WP_061581461.1 competence pheromone ComX -
  C7M21_RS07995 (C7M21_01600) comP 1571560..1573851 (+) 2292 WP_160223246.1 histidine kinase Regulator
  C7M21_RS08000 (C7M21_01601) comA 1573932..1574576 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  C7M21_RS08005 (C7M21_01602) - 1574598..1574981 (+) 384 WP_012118312.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=282712 C7M21_RS07980 WP_003152043.1 1570181..1570321(+) (degQ) [Bacillus velezensis strain SRCM102743]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=282712 C7M21_RS07980 WP_003152043.1 1570181..1570321(+) (degQ) [Bacillus velezensis strain SRCM102743]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment