Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   C7M16_RS11150 Genome accession   NZ_CP028201
Coordinates   2235415..2235789 (-) Length   124 a.a.
NCBI ID   WP_033884701.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM102753     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2230415..2240789
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M16_RS11110 (C7M16_02193) yqhG 2230746..2231540 (+) 795 WP_003230200.1 YqhG family protein -
  C7M16_RS11115 (C7M16_02194) sinI 2231723..2231896 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  C7M16_RS11120 (C7M16_02195) sinR 2231930..2232265 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C7M16_RS11125 (C7M16_02196) tasA 2232358..2233143 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  C7M16_RS11130 (C7M16_02197) sipW 2233207..2233779 (-) 573 WP_003246088.1 signal peptidase I SipW -
  C7M16_RS11135 (C7M16_02198) tapA 2233763..2234524 (-) 762 WP_160221678.1 amyloid fiber anchoring/assembly protein TapA -
  C7M16_RS11140 (C7M16_02199) yqzG 2234796..2235122 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  C7M16_RS11145 (C7M16_02200) spoIITA 2235164..2235343 (-) 180 WP_014480252.1 YqzE family protein -
  C7M16_RS11150 (C7M16_02201) comGG 2235415..2235789 (-) 375 WP_033884701.1 ComG operon protein ComGG Machinery gene
  C7M16_RS11155 comGF 2235790..2236173 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  C7M16_RS11160 (C7M16_02203) comGE 2236199..2236546 (-) 348 WP_033884703.1 ComG operon protein 5 Machinery gene
  C7M16_RS11165 (C7M16_02204) comGD 2236530..2236961 (-) 432 WP_015714255.1 comG operon protein ComGD Machinery gene
  C7M16_RS11170 (C7M16_02205) comGC 2236951..2237247 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  C7M16_RS11175 (C7M16_02206) comGB 2237261..2238298 (-) 1038 WP_072175548.1 comG operon protein ComGB Machinery gene
  C7M16_RS11180 (C7M16_02207) comGA 2238285..2239355 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  C7M16_RS11185 (C7M16_02209) - 2239583..2239765 (-) 183 WP_033884706.1 hypothetical protein -
  C7M16_RS11190 (C7M16_02210) corA 2239767..2240720 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14511.69 Da        Isoelectric Point: 9.2806

>NTDB_id=282335 C7M16_RS11150 WP_033884701.1 2235415..2235789(-) (comGG) [Bacillus subtilis strain SRCM102753]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGTLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=282335 C7M16_RS11150 WP_033884701.1 2235415..2235789(-) (comGG) [Bacillus subtilis strain SRCM102753]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGTA
CGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGACCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

96.774

100

0.968

Multiple sequence alignment