Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   C7M16_RS11115 Genome accession   NZ_CP028201
Coordinates   2231723..2231896 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SRCM102753     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2226723..2236896
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M16_RS11100 (C7M16_02191) gcvT 2227522..2228610 (-) 1089 WP_029317919.1 glycine cleavage system aminomethyltransferase GcvT -
  C7M16_RS11105 (C7M16_02192) hepAA 2229052..2230725 (+) 1674 WP_041850014.1 SNF2-related protein -
  C7M16_RS11110 (C7M16_02193) yqhG 2230746..2231540 (+) 795 WP_003230200.1 YqhG family protein -
  C7M16_RS11115 (C7M16_02194) sinI 2231723..2231896 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  C7M16_RS11120 (C7M16_02195) sinR 2231930..2232265 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C7M16_RS11125 (C7M16_02196) tasA 2232358..2233143 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  C7M16_RS11130 (C7M16_02197) sipW 2233207..2233779 (-) 573 WP_003246088.1 signal peptidase I SipW -
  C7M16_RS11135 (C7M16_02198) tapA 2233763..2234524 (-) 762 WP_160221678.1 amyloid fiber anchoring/assembly protein TapA -
  C7M16_RS11140 (C7M16_02199) yqzG 2234796..2235122 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  C7M16_RS11145 (C7M16_02200) spoIITA 2235164..2235343 (-) 180 WP_014480252.1 YqzE family protein -
  C7M16_RS11150 (C7M16_02201) comGG 2235415..2235789 (-) 375 WP_033884701.1 ComG operon protein ComGG Machinery gene
  C7M16_RS11155 comGF 2235790..2236173 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  C7M16_RS11160 (C7M16_02203) comGE 2236199..2236546 (-) 348 WP_033884703.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=282333 C7M16_RS11115 WP_003230187.1 2231723..2231896(+) (sinI) [Bacillus subtilis strain SRCM102753]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=282333 C7M16_RS11115 WP_003230187.1 2231723..2231896(+) (sinI) [Bacillus subtilis strain SRCM102753]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment