Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | C9J77_RS06460 | Genome accession | NZ_CP028163 |
| Coordinates | 1256661..1257131 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934770.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain CFSAN064038 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1234358..1285803 | 1256661..1257131 | within | 0 |
Gene organization within MGE regions
Location: 1234358..1285803
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C9J77_RS06305 (C9J77_06300) | groES | 1234358..1234642 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| C9J77_RS06310 (C9J77_06305) | groL | 1234718..1236334 (+) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| C9J77_RS06315 (C9J77_06310) | - | 1236875..1237054 (+) | 180 | WP_000201398.1 | hypothetical protein | - |
| C9J77_RS15250 | - | 1237051..1237677 (+) | 627 | WP_000216896.1 | hypothetical protein | - |
| C9J77_RS06335 (C9J77_06330) | - | 1238216..1239523 (-) | 1308 | WP_001045074.1 | TrkH family potassium uptake protein | - |
| C9J77_RS06345 (C9J77_06340) | - | 1239906..1241129 (-) | 1224 | WP_000206618.1 | ArgE/DapE family deacylase | - |
| C9J77_RS06350 (C9J77_06345) | - | 1241561..1242616 (+) | 1056 | WP_000791397.1 | leukocidin family pore-forming toxin | - |
| C9J77_RS06355 (C9J77_06350) | - | 1242638..1243654 (+) | 1017 | WP_000595612.1 | leukocidin/hemolysin toxin family protein | - |
| C9J77_RS06360 (C9J77_06355) | sph | 1243916..1244731 (-) | 816 | Protein_1206 | sphingomyelin phosphodiesterase | - |
| C9J77_RS06365 (C9J77_06360) | - | 1244798..1245835 (-) | 1038 | WP_061651379.1 | site-specific integrase | - |
| C9J77_RS06370 (C9J77_06365) | - | 1246026..1246739 (-) | 714 | WP_001549185.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| C9J77_RS06375 (C9J77_06370) | - | 1246818..1247000 (-) | 183 | WP_000705243.1 | hypothetical protein | - |
| C9J77_RS06380 (C9J77_06375) | - | 1247156..1247854 (-) | 699 | WP_000837517.1 | potassium channel family protein | - |
| C9J77_RS06385 (C9J77_06380) | - | 1248036..1248668 (-) | 633 | WP_031763806.1 | XRE family transcriptional regulator | - |
| C9J77_RS06390 (C9J77_06385) | - | 1248822..1249049 (+) | 228 | WP_000192116.1 | helix-turn-helix transcriptional regulator | - |
| C9J77_RS06395 (C9J77_06390) | - | 1249072..1249860 (+) | 789 | WP_031763800.1 | phage antirepressor KilAC domain-containing protein | - |
| C9J77_RS06400 (C9J77_06395) | - | 1249873..1250316 (+) | 444 | WP_001662741.1 | hypothetical protein | - |
| C9J77_RS06405 (C9J77_06400) | - | 1250331..1250471 (+) | 141 | WP_000939495.1 | hypothetical protein | - |
| C9J77_RS06410 (C9J77_06405) | - | 1250464..1250673 (-) | 210 | WP_000772137.1 | hypothetical protein | - |
| C9J77_RS06415 (C9J77_06410) | - | 1250730..1251479 (+) | 750 | WP_001148337.1 | phage antirepressor KilAC domain-containing protein | - |
| C9J77_RS06420 (C9J77_06415) | - | 1251492..1251752 (+) | 261 | WP_000435343.1 | hypothetical protein | - |
| C9J77_RS15395 | - | 1251776..1251931 (-) | 156 | Protein_1219 | hypothetical protein | - |
| C9J77_RS06425 (C9J77_06420) | - | 1251985..1252305 (+) | 321 | WP_001120936.1 | DUF771 domain-containing protein | - |
| C9J77_RS06430 (C9J77_06425) | - | 1252302..1252463 (+) | 162 | WP_000066011.1 | DUF1270 domain-containing protein | - |
| C9J77_RS06435 (C9J77_06430) | - | 1252556..1252816 (+) | 261 | WP_000291488.1 | DUF1108 family protein | - |
| C9J77_RS06440 (C9J77_06435) | - | 1252825..1253088 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| C9J77_RS06445 (C9J77_06440) | - | 1253085..1255040 (+) | 1956 | WP_064127293.1 | AAA family ATPase | - |
| C9J77_RS06450 (C9J77_06445) | - | 1255042..1255962 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| C9J77_RS06455 (C9J77_06450) | - | 1256043..1256660 (+) | 618 | WP_072460574.1 | MBL fold metallo-hydrolase | - |
| C9J77_RS06460 (C9J77_06455) | ssbA | 1256661..1257131 (+) | 471 | WP_000934770.1 | single-stranded DNA-binding protein | Machinery gene |
| C9J77_RS06465 (C9J77_06460) | - | 1257161..1258045 (+) | 885 | WP_107303195.1 | DnaD domain protein | - |
| C9J77_RS06470 (C9J77_06465) | - | 1258052..1258270 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| C9J77_RS06475 (C9J77_06470) | - | 1258279..1258683 (+) | 405 | WP_000401964.1 | RusA family crossover junction endodeoxyribonuclease | - |
| C9J77_RS06480 (C9J77_06475) | - | 1258696..1259064 (+) | 369 | WP_000101270.1 | SA1788 family PVL leukocidin-associated protein | - |
| C9J77_RS06485 (C9J77_06480) | - | 1259068..1259310 (+) | 243 | WP_000131381.1 | phi PVL orf 51-like protein | - |
| C9J77_RS06490 (C9J77_06485) | - | 1259325..1259579 (+) | 255 | WP_107303196.1 | DUF1024 family protein | - |
| C9J77_RS06495 (C9J77_06490) | - | 1259566..1259736 (+) | 171 | WP_000714407.1 | hypothetical protein | - |
| C9J77_RS06500 (C9J77_06495) | - | 1259729..1260265 (+) | 537 | WP_031881549.1 | dUTPase | - |
| C9J77_RS06505 (C9J77_06500) | - | 1260302..1260508 (+) | 207 | WP_000195794.1 | DUF1381 domain-containing protein | - |
| C9J77_RS06510 (C9J77_06505) | - | 1260505..1260708 (+) | 204 | WP_000141180.1 | hypothetical protein | - |
| C9J77_RS06515 (C9J77_06510) | - | 1260701..1260937 (+) | 237 | WP_107303198.1 | hypothetical protein | - |
| C9J77_RS06520 (C9J77_06515) | - | 1260927..1261316 (+) | 390 | WP_001596346.1 | hypothetical protein | - |
| C9J77_RS06525 (C9J77_06520) | - | 1261313..1261462 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| C9J77_RS06530 (C9J77_06525) | - | 1261621..1262271 (+) | 651 | WP_001005262.1 | hypothetical protein | - |
| C9J77_RS06535 (C9J77_06530) | - | 1262271..1262471 (+) | 201 | WP_001794311.1 | DUF1514 family protein | - |
| C9J77_RS06540 (C9J77_06535) | - | 1262499..1262915 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| C9J77_RS06545 (C9J77_06540) | - | 1263147..1263446 (+) | 300 | WP_000988330.1 | HNH endonuclease | - |
| C9J77_RS06550 (C9J77_06545) | - | 1263577..1263921 (+) | 345 | WP_000402904.1 | hypothetical protein | - |
| C9J77_RS06555 (C9J77_06550) | - | 1263918..1265579 (+) | 1662 | WP_000625088.1 | terminase large subunit | - |
| C9J77_RS06560 (C9J77_06555) | - | 1265595..1266782 (+) | 1188 | WP_000025274.1 | phage portal protein | - |
| C9J77_RS06565 (C9J77_06560) | - | 1266766..1267503 (+) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| C9J77_RS06570 (C9J77_06565) | - | 1267527..1268672 (+) | 1146 | WP_000154558.1 | phage major capsid protein | - |
| C9J77_RS06575 (C9J77_06570) | - | 1268692..1268976 (+) | 285 | WP_000238240.1 | hypothetical protein | - |
| C9J77_RS06580 (C9J77_06575) | - | 1268966..1269250 (+) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| C9J77_RS06585 (C9J77_06580) | - | 1269234..1269596 (+) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| C9J77_RS06590 (C9J77_06585) | - | 1269593..1269997 (+) | 405 | WP_000114341.1 | HK97 gp10 family phage protein | - |
| C9J77_RS06595 (C9J77_06590) | - | 1269994..1270401 (+) | 408 | WP_000565498.1 | hypothetical protein | - |
| C9J77_RS06600 (C9J77_06595) | - | 1270402..1271046 (+) | 645 | WP_000268736.1 | major tail protein | - |
| C9J77_RS06605 (C9J77_06600) | - | 1271100..1271312 (+) | 213 | WP_078101489.1 | Ig-like domain-containing protein | - |
| C9J77_RS06610 (C9J77_06605) | - | 1271362..1271712 (+) | 351 | WP_001096353.1 | hypothetical protein | - |
| C9J77_RS15255 | - | 1271763..1271900 (+) | 138 | WP_001549167.1 | hypothetical protein | - |
| C9J77_RS06615 (C9J77_06610) | - | 1271957..1276489 (+) | 4533 | WP_107303199.1 | phage tail tape measure protein | - |
| C9J77_RS06620 (C9J77_06615) | - | 1276486..1277970 (+) | 1485 | WP_000567408.1 | phage tail domain-containing protein | - |
| C9J77_RS06625 (C9J77_06620) | - | 1277986..1281771 (+) | 3786 | WP_000582186.1 | phage tail spike protein | - |
| C9J77_RS06630 (C9J77_06625) | - | 1281761..1281913 (+) | 153 | WP_001153681.1 | hypothetical protein | - |
| C9J77_RS06635 (C9J77_06630) | - | 1281960..1282247 (+) | 288 | WP_001040261.1 | hypothetical protein | - |
| C9J77_RS06640 (C9J77_06635) | - | 1282305..1282601 (+) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| C9J77_RS06645 (C9J77_06640) | pepG1 | 1282793..1282927 (+) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| C9J77_RS06650 (C9J77_06645) | - | 1282980..1283087 (-) | 108 | WP_031790389.1 | hypothetical protein | - |
| C9J77_RS06655 (C9J77_06650) | - | 1283139..1283393 (+) | 255 | WP_000611512.1 | phage holin | - |
| C9J77_RS06660 (C9J77_06655) | - | 1283405..1284160 (+) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| C9J77_RS06665 (C9J77_06660) | sak | 1284351..1284842 (+) | 492 | WP_000920041.1 | staphylokinase | - |
| C9J77_RS06670 (C9J77_06665) | scn | 1285453..1285803 (+) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17713.63 Da Isoelectric Point: 5.2672
>NTDB_id=281885 C9J77_RS06460 WP_000934770.1 1256661..1257131(+) (ssbA) [Staphylococcus aureus strain CFSAN064038]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=281885 C9J77_RS06460 WP_000934770.1 1256661..1257131(+) (ssbA) [Staphylococcus aureus strain CFSAN064038]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |