Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   C9J77_RS06460 Genome accession   NZ_CP028163
Coordinates   1256661..1257131 (+) Length   156 a.a.
NCBI ID   WP_000934770.1    Uniprot ID   -
Organism   Staphylococcus aureus strain CFSAN064038     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1234358..1285803 1256661..1257131 within 0


Gene organization within MGE regions


Location: 1234358..1285803
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C9J77_RS06305 (C9J77_06300) groES 1234358..1234642 (+) 285 WP_000917289.1 co-chaperone GroES -
  C9J77_RS06310 (C9J77_06305) groL 1234718..1236334 (+) 1617 WP_000240642.1 chaperonin GroEL -
  C9J77_RS06315 (C9J77_06310) - 1236875..1237054 (+) 180 WP_000201398.1 hypothetical protein -
  C9J77_RS15250 - 1237051..1237677 (+) 627 WP_000216896.1 hypothetical protein -
  C9J77_RS06335 (C9J77_06330) - 1238216..1239523 (-) 1308 WP_001045074.1 TrkH family potassium uptake protein -
  C9J77_RS06345 (C9J77_06340) - 1239906..1241129 (-) 1224 WP_000206618.1 ArgE/DapE family deacylase -
  C9J77_RS06350 (C9J77_06345) - 1241561..1242616 (+) 1056 WP_000791397.1 leukocidin family pore-forming toxin -
  C9J77_RS06355 (C9J77_06350) - 1242638..1243654 (+) 1017 WP_000595612.1 leukocidin/hemolysin toxin family protein -
  C9J77_RS06360 (C9J77_06355) sph 1243916..1244731 (-) 816 Protein_1206 sphingomyelin phosphodiesterase -
  C9J77_RS06365 (C9J77_06360) - 1244798..1245835 (-) 1038 WP_061651379.1 site-specific integrase -
  C9J77_RS06370 (C9J77_06365) - 1246026..1246739 (-) 714 WP_001549185.1 type II toxin-antitoxin system PemK/MazF family toxin -
  C9J77_RS06375 (C9J77_06370) - 1246818..1247000 (-) 183 WP_000705243.1 hypothetical protein -
  C9J77_RS06380 (C9J77_06375) - 1247156..1247854 (-) 699 WP_000837517.1 potassium channel family protein -
  C9J77_RS06385 (C9J77_06380) - 1248036..1248668 (-) 633 WP_031763806.1 XRE family transcriptional regulator -
  C9J77_RS06390 (C9J77_06385) - 1248822..1249049 (+) 228 WP_000192116.1 helix-turn-helix transcriptional regulator -
  C9J77_RS06395 (C9J77_06390) - 1249072..1249860 (+) 789 WP_031763800.1 phage antirepressor KilAC domain-containing protein -
  C9J77_RS06400 (C9J77_06395) - 1249873..1250316 (+) 444 WP_001662741.1 hypothetical protein -
  C9J77_RS06405 (C9J77_06400) - 1250331..1250471 (+) 141 WP_000939495.1 hypothetical protein -
  C9J77_RS06410 (C9J77_06405) - 1250464..1250673 (-) 210 WP_000772137.1 hypothetical protein -
  C9J77_RS06415 (C9J77_06410) - 1250730..1251479 (+) 750 WP_001148337.1 phage antirepressor KilAC domain-containing protein -
  C9J77_RS06420 (C9J77_06415) - 1251492..1251752 (+) 261 WP_000435343.1 hypothetical protein -
  C9J77_RS15395 - 1251776..1251931 (-) 156 Protein_1219 hypothetical protein -
  C9J77_RS06425 (C9J77_06420) - 1251985..1252305 (+) 321 WP_001120936.1 DUF771 domain-containing protein -
  C9J77_RS06430 (C9J77_06425) - 1252302..1252463 (+) 162 WP_000066011.1 DUF1270 domain-containing protein -
  C9J77_RS06435 (C9J77_06430) - 1252556..1252816 (+) 261 WP_000291488.1 DUF1108 family protein -
  C9J77_RS06440 (C9J77_06435) - 1252825..1253088 (+) 264 WP_001205732.1 hypothetical protein -
  C9J77_RS06445 (C9J77_06440) - 1253085..1255040 (+) 1956 WP_064127293.1 AAA family ATPase -
  C9J77_RS06450 (C9J77_06445) - 1255042..1255962 (+) 921 WP_000138475.1 recombinase RecT -
  C9J77_RS06455 (C9J77_06450) - 1256043..1256660 (+) 618 WP_072460574.1 MBL fold metallo-hydrolase -
  C9J77_RS06460 (C9J77_06455) ssbA 1256661..1257131 (+) 471 WP_000934770.1 single-stranded DNA-binding protein Machinery gene
  C9J77_RS06465 (C9J77_06460) - 1257161..1258045 (+) 885 WP_107303195.1 DnaD domain protein -
  C9J77_RS06470 (C9J77_06465) - 1258052..1258270 (+) 219 WP_000338528.1 hypothetical protein -
  C9J77_RS06475 (C9J77_06470) - 1258279..1258683 (+) 405 WP_000401964.1 RusA family crossover junction endodeoxyribonuclease -
  C9J77_RS06480 (C9J77_06475) - 1258696..1259064 (+) 369 WP_000101270.1 SA1788 family PVL leukocidin-associated protein -
  C9J77_RS06485 (C9J77_06480) - 1259068..1259310 (+) 243 WP_000131381.1 phi PVL orf 51-like protein -
  C9J77_RS06490 (C9J77_06485) - 1259325..1259579 (+) 255 WP_107303196.1 DUF1024 family protein -
  C9J77_RS06495 (C9J77_06490) - 1259566..1259736 (+) 171 WP_000714407.1 hypothetical protein -
  C9J77_RS06500 (C9J77_06495) - 1259729..1260265 (+) 537 WP_031881549.1 dUTPase -
  C9J77_RS06505 (C9J77_06500) - 1260302..1260508 (+) 207 WP_000195794.1 DUF1381 domain-containing protein -
  C9J77_RS06510 (C9J77_06505) - 1260505..1260708 (+) 204 WP_000141180.1 hypothetical protein -
  C9J77_RS06515 (C9J77_06510) - 1260701..1260937 (+) 237 WP_107303198.1 hypothetical protein -
  C9J77_RS06520 (C9J77_06515) - 1260927..1261316 (+) 390 WP_001596346.1 hypothetical protein -
  C9J77_RS06525 (C9J77_06520) - 1261313..1261462 (+) 150 WP_000595265.1 transcriptional activator RinB -
  C9J77_RS06530 (C9J77_06525) - 1261621..1262271 (+) 651 WP_001005262.1 hypothetical protein -
  C9J77_RS06535 (C9J77_06530) - 1262271..1262471 (+) 201 WP_001794311.1 DUF1514 family protein -
  C9J77_RS06540 (C9J77_06535) - 1262499..1262915 (+) 417 WP_000590122.1 hypothetical protein -
  C9J77_RS06545 (C9J77_06540) - 1263147..1263446 (+) 300 WP_000988330.1 HNH endonuclease -
  C9J77_RS06550 (C9J77_06545) - 1263577..1263921 (+) 345 WP_000402904.1 hypothetical protein -
  C9J77_RS06555 (C9J77_06550) - 1263918..1265579 (+) 1662 WP_000625088.1 terminase large subunit -
  C9J77_RS06560 (C9J77_06555) - 1265595..1266782 (+) 1188 WP_000025274.1 phage portal protein -
  C9J77_RS06565 (C9J77_06560) - 1266766..1267503 (+) 738 WP_000642728.1 head maturation protease, ClpP-related -
  C9J77_RS06570 (C9J77_06565) - 1267527..1268672 (+) 1146 WP_000154558.1 phage major capsid protein -
  C9J77_RS06575 (C9J77_06570) - 1268692..1268976 (+) 285 WP_000238240.1 hypothetical protein -
  C9J77_RS06580 (C9J77_06575) - 1268966..1269250 (+) 285 WP_000150936.1 phage head-tail adapter protein -
  C9J77_RS06585 (C9J77_06580) - 1269234..1269596 (+) 363 WP_000755150.1 head-tail adaptor protein -
  C9J77_RS06590 (C9J77_06585) - 1269593..1269997 (+) 405 WP_000114341.1 HK97 gp10 family phage protein -
  C9J77_RS06595 (C9J77_06590) - 1269994..1270401 (+) 408 WP_000565498.1 hypothetical protein -
  C9J77_RS06600 (C9J77_06595) - 1270402..1271046 (+) 645 WP_000268736.1 major tail protein -
  C9J77_RS06605 (C9J77_06600) - 1271100..1271312 (+) 213 WP_078101489.1 Ig-like domain-containing protein -
  C9J77_RS06610 (C9J77_06605) - 1271362..1271712 (+) 351 WP_001096353.1 hypothetical protein -
  C9J77_RS15255 - 1271763..1271900 (+) 138 WP_001549167.1 hypothetical protein -
  C9J77_RS06615 (C9J77_06610) - 1271957..1276489 (+) 4533 WP_107303199.1 phage tail tape measure protein -
  C9J77_RS06620 (C9J77_06615) - 1276486..1277970 (+) 1485 WP_000567408.1 phage tail domain-containing protein -
  C9J77_RS06625 (C9J77_06620) - 1277986..1281771 (+) 3786 WP_000582186.1 phage tail spike protein -
  C9J77_RS06630 (C9J77_06625) - 1281761..1281913 (+) 153 WP_001153681.1 hypothetical protein -
  C9J77_RS06635 (C9J77_06630) - 1281960..1282247 (+) 288 WP_001040261.1 hypothetical protein -
  C9J77_RS06640 (C9J77_06635) - 1282305..1282601 (+) 297 WP_000539688.1 DUF2951 domain-containing protein -
  C9J77_RS06645 (C9J77_06640) pepG1 1282793..1282927 (+) 135 WP_000226108.1 type I toxin-antitoxin system toxin PepG1 -
  C9J77_RS06650 (C9J77_06645) - 1282980..1283087 (-) 108 WP_031790389.1 hypothetical protein -
  C9J77_RS06655 (C9J77_06650) - 1283139..1283393 (+) 255 WP_000611512.1 phage holin -
  C9J77_RS06660 (C9J77_06655) - 1283405..1284160 (+) 756 WP_000861038.1 CHAP domain-containing protein -
  C9J77_RS06665 (C9J77_06660) sak 1284351..1284842 (+) 492 WP_000920041.1 staphylokinase -
  C9J77_RS06670 (C9J77_06665) scn 1285453..1285803 (+) 351 WP_000702263.1 complement inhibitor SCIN-A -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17713.63 Da        Isoelectric Point: 5.2672

>NTDB_id=281885 C9J77_RS06460 WP_000934770.1 1256661..1257131(+) (ssbA) [Staphylococcus aureus strain CFSAN064038]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=281885 C9J77_RS06460 WP_000934770.1 1256661..1257131(+) (ssbA) [Staphylococcus aureus strain CFSAN064038]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365


Multiple sequence alignment