Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   D4J22_RS07665 Genome accession   NZ_CP032905
Coordinates   1547028..1547141 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   Q9ZEL1
Organism   Helicobacter pylori strain 26-A-EK1     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1542028..1552141
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D4J22_RS07645 - 1542684..1544096 (-) 1413 WP_139547575.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  D4J22_RS07650 comB10 1544167..1545303 (-) 1137 WP_139547576.1 DNA type IV secretion system protein ComB10 Machinery gene
  D4J22_RS07655 comB9 1545296..1546288 (-) 993 WP_139547577.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  D4J22_RS07660 comB8 1546288..1547031 (-) 744 WP_108539514.1 virB8 family protein Machinery gene
  D4J22_RS07665 comB7 1547028..1547141 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  D4J22_RS07670 comB6 1547157..1548212 (-) 1056 WP_139547578.1 P-type conjugative transfer protein TrbL Machinery gene
  D4J22_RS07675 - 1548220..1549215 (-) 996 WP_139547670.1 PDZ domain-containing protein -
  D4J22_RS07680 - 1549215..1549508 (-) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  D4J22_RS07685 panD 1549519..1549869 (-) 351 WP_108593697.1 aspartate 1-decarboxylase -
  D4J22_RS07690 - 1549859..1552084 (-) 2226 WP_139547579.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=280798 D4J22_RS07665 WP_001217873.1 1547028..1547141(-) (comB7) [Helicobacter pylori strain 26-A-EK1]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=280798 D4J22_RS07665 WP_001217873.1 1547028..1547141(-) (comB7) [Helicobacter pylori strain 26-A-EK1]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9ZEL1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment