Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | C5E18_RS11715 | Genome accession | NZ_CP027260 |
| Coordinates | 2464905..2465357 (-) | Length | 150 a.a. |
| NCBI ID | WP_127087911.1 | Uniprot ID | - |
| Organism | Pectobacterium parmentieri strain IFB5427 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2460604..2509909 | 2464905..2465357 | within | 0 |
Gene organization within MGE regions
Location: 2460604..2509909
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C5E18_RS11680 (C5E18_11725) | - | 2460841..2462025 (+) | 1185 | WP_127087904.1 | tyrosine-type recombinase/integrase | - |
| C5E18_RS11690 (C5E18_11735) | - | 2462225..2462446 (-) | 222 | WP_127087906.1 | hypothetical protein | - |
| C5E18_RS11695 (C5E18_11740) | - | 2462791..2463045 (-) | 255 | WP_127087907.1 | hypothetical protein | - |
| C5E18_RS11700 (C5E18_11745) | - | 2463252..2464295 (-) | 1044 | WP_127087908.1 | hypothetical protein | - |
| C5E18_RS11710 (C5E18_11755) | - | 2464501..2464833 (-) | 333 | WP_127087910.1 | hypothetical protein | - |
| C5E18_RS11715 (C5E18_11760) | ssb | 2464905..2465357 (-) | 453 | WP_127087911.1 | single-stranded DNA-binding protein | Machinery gene |
| C5E18_RS11720 (C5E18_11765) | - | 2465358..2465981 (-) | 624 | WP_127087912.1 | ERF family protein | - |
| C5E18_RS11725 | - | 2466422..2466709 (-) | 288 | WP_127087913.1 | hypothetical protein | - |
| C5E18_RS24760 | - | 2466905..2467081 (-) | 177 | WP_157985455.1 | hypothetical protein | - |
| C5E18_RS11730 (C5E18_11770) | - | 2467115..2467393 (-) | 279 | WP_127087914.1 | hypothetical protein | - |
| C5E18_RS25210 (C5E18_11775) | - | 2467435..2467656 (-) | 222 | WP_127087915.1 | hypothetical protein | - |
| C5E18_RS11740 (C5E18_11780) | - | 2467658..2467900 (-) | 243 | WP_127087916.1 | transcriptional regulator | - |
| C5E18_RS11745 (C5E18_11785) | - | 2468561..2468962 (-) | 402 | WP_127087917.1 | protein-export chaperone SecB | - |
| C5E18_RS11750 (C5E18_11790) | - | 2468967..2469629 (-) | 663 | WP_127087918.1 | helix-turn-helix domain-containing protein | - |
| C5E18_RS11755 (C5E18_11795) | - | 2469626..2469931 (-) | 306 | WP_232830238.1 | type II toxin-antitoxin system HigB family toxin | - |
| C5E18_RS11760 (C5E18_11800) | - | 2470024..2470677 (-) | 654 | WP_127087919.1 | XRE family transcriptional regulator | - |
| C5E18_RS11765 (C5E18_11805) | - | 2470776..2470991 (+) | 216 | WP_127087920.1 | helix-turn-helix domain-containing protein | - |
| C5E18_RS11770 (C5E18_11810) | - | 2471093..2471407 (+) | 315 | WP_127087921.1 | CII family transcriptional regulator | - |
| C5E18_RS24900 | - | 2471420..2471572 (+) | 153 | WP_198340262.1 | hypothetical protein | - |
| C5E18_RS11775 (C5E18_11815) | - | 2471556..2472467 (+) | 912 | WP_127087922.1 | DNA replication protein | - |
| C5E18_RS11780 (C5E18_11820) | - | 2472457..2473860 (+) | 1404 | WP_127087923.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| C5E18_RS11785 (C5E18_11825) | - | 2473885..2474151 (+) | 267 | WP_127087924.1 | hypothetical protein | - |
| C5E18_RS11790 (C5E18_11830) | - | 2474277..2474486 (+) | 210 | WP_127087925.1 | DUF551 domain-containing protein | - |
| C5E18_RS11795 (C5E18_11835) | - | 2474799..2475224 (+) | 426 | WP_127087926.1 | hypothetical protein | - |
| C5E18_RS11800 (C5E18_11840) | - | 2475235..2475684 (+) | 450 | WP_127087927.1 | DUF1367 family protein | - |
| C5E18_RS11805 (C5E18_11850) | - | 2475991..2476584 (+) | 594 | WP_127087928.1 | MT-A70 family methyltransferase | - |
| C5E18_RS11810 (C5E18_11855) | - | 2476617..2476754 (+) | 138 | WP_338045387.1 | NinE family protein | - |
| C5E18_RS11815 (C5E18_11860) | - | 2476751..2477122 (+) | 372 | WP_127087930.1 | DUF5448 family protein | - |
| C5E18_RS11820 (C5E18_11870) | - | 2477299..2477589 (+) | 291 | WP_127087931.1 | DUF1364 domain-containing protein | - |
| C5E18_RS11825 (C5E18_11875) | - | 2477586..2477948 (+) | 363 | WP_127087932.1 | RusA family crossover junction endodeoxyribonuclease | - |
| C5E18_RS11830 | - | 2477945..2478799 (+) | 855 | WP_127087933.1 | hypothetical protein | - |
| C5E18_RS11835 (C5E18_11890) | - | 2478796..2479182 (+) | 387 | WP_127087934.1 | hypothetical protein | - |
| C5E18_RS11840 (C5E18_11895) | - | 2479282..2479773 (+) | 492 | WP_127087935.1 | antiterminator Q family protein | - |
| C5E18_RS24905 | - | 2479889..2480056 (-) | 168 | WP_198340268.1 | hypothetical protein | - |
| C5E18_RS11845 (C5E18_11900) | - | 2480061..2480321 (-) | 261 | WP_127087936.1 | hypothetical protein | - |
| C5E18_RS11850 (C5E18_11905) | - | 2480459..2480665 (+) | 207 | WP_232487924.1 | class II holin family protein | - |
| C5E18_RS11855 (C5E18_11910) | - | 2480668..2481177 (+) | 510 | WP_416054001.1 | lysozyme | - |
| C5E18_RS11860 (C5E18_11915) | - | 2481156..2481587 (+) | 432 | WP_127087939.1 | lysis protein | - |
| C5E18_RS11865 (C5E18_11920) | - | 2481565..2481777 (-) | 213 | WP_127087940.1 | hypothetical protein | - |
| C5E18_RS11870 (C5E18_11925) | - | 2481777..2481980 (-) | 204 | WP_127087941.1 | YccJ family protein | - |
| C5E18_RS11875 (C5E18_11930) | - | 2482276..2482548 (+) | 273 | WP_010281978.1 | hypothetical protein | - |
| C5E18_RS11880 (C5E18_11935) | - | 2482550..2482801 (+) | 252 | WP_010281983.1 | hypothetical protein | - |
| C5E18_RS11885 (C5E18_11940) | - | 2482918..2483202 (+) | 285 | WP_127087942.1 | hypothetical protein | - |
| C5E18_RS11890 (C5E18_11945) | - | 2483217..2483486 (+) | 270 | WP_127087943.1 | DUF2560 family protein | - |
| C5E18_RS11895 (C5E18_11955) | - | 2483740..2484513 (+) | 774 | WP_127087944.1 | hypothetical protein | - |
| C5E18_RS11900 (C5E18_11960) | - | 2484530..2485147 (+) | 618 | WP_127087945.1 | putative metallopeptidase | - |
| C5E18_RS11905 (C5E18_11965) | - | 2485179..2485646 (+) | 468 | WP_127087946.1 | DUF2280 domain-containing protein | - |
| C5E18_RS11910 (C5E18_11970) | - | 2485630..2486946 (+) | 1317 | WP_127087947.1 | PBSX family phage terminase large subunit | - |
| C5E18_RS11915 (C5E18_11975) | - | 2486957..2488312 (+) | 1356 | WP_127087948.1 | anti-CBASS protein Acb1 family protein | - |
| C5E18_RS11920 (C5E18_11980) | - | 2488263..2489189 (+) | 927 | WP_127087949.1 | phage minor head protein | - |
| C5E18_RS11925 (C5E18_11985) | - | 2489193..2490473 (+) | 1281 | WP_127087950.1 | hypothetical protein | - |
| C5E18_RS11930 (C5E18_11990) | - | 2490473..2490913 (+) | 441 | WP_127087951.1 | hypothetical protein | - |
| C5E18_RS25215 (C5E18_11995) | - | 2490928..2492025 (+) | 1098 | WP_232487919.1 | major capsid protein | - |
| C5E18_RS11940 (C5E18_12000) | - | 2492035..2492328 (+) | 294 | WP_127087989.1 | hypothetical protein | - |
| C5E18_RS11945 (C5E18_12005) | - | 2492395..2492793 (+) | 399 | WP_127087952.1 | DUF7370 family protein | - |
| C5E18_RS24910 | - | 2492793..2492963 (+) | 171 | WP_198340271.1 | hypothetical protein | - |
| C5E18_RS11950 (C5E18_12010) | - | 2492960..2493301 (+) | 342 | WP_127087953.1 | hypothetical protein | - |
| C5E18_RS11955 (C5E18_12015) | - | 2493303..2493674 (+) | 372 | WP_127087954.1 | HK97 gp10 family phage protein | - |
| C5E18_RS11960 (C5E18_12020) | - | 2493671..2494045 (+) | 375 | WP_127087955.1 | hypothetical protein | - |
| C5E18_RS11965 (C5E18_12025) | - | 2494102..2494845 (+) | 744 | WP_127087956.1 | Ig-like domain-containing protein | - |
| C5E18_RS11970 (C5E18_12030) | - | 2494896..2495576 (+) | 681 | WP_127087957.1 | DUF6246 family protein | - |
| C5E18_RS11975 (C5E18_12035) | - | 2495768..2496523 (+) | 756 | WP_127087958.1 | KilA-N domain-containing protein | - |
| C5E18_RS11980 (C5E18_12040) | - | 2496689..2497024 (+) | 336 | WP_127087959.1 | hypothetical protein | - |
| C5E18_RS11985 (C5E18_12045) | - | 2497021..2497347 (+) | 327 | WP_127087960.1 | hypothetical protein | - |
| C5E18_RS11990 (C5E18_12050) | - | 2497344..2497802 (+) | 459 | WP_127087961.1 | hypothetical protein | - |
| C5E18_RS11995 (C5E18_12055) | - | 2497860..2501579 (+) | 3720 | WP_127087962.1 | tape measure protein | - |
| C5E18_RS12000 (C5E18_12060) | - | 2501622..2501801 (+) | 180 | WP_127087963.1 | Rrf2 family transcriptional regulator | - |
| C5E18_RS12005 (C5E18_12065) | - | 2501781..2502044 (-) | 264 | WP_127087964.1 | DUF1883 domain-containing protein | - |
| C5E18_RS12010 (C5E18_12070) | - | 2502148..2502390 (-) | 243 | WP_127087965.1 | Arc family DNA-binding protein | - |
| C5E18_RS12015 (C5E18_12075) | - | 2502491..2502637 (+) | 147 | WP_127087966.1 | Arc family DNA-binding protein | - |
| C5E18_RS12020 (C5E18_12080) | - | 2502706..2503602 (+) | 897 | WP_127087967.1 | phage antirepressor N-terminal domain-containing protein | - |
| C5E18_RS12025 (C5E18_12085) | - | 2503657..2504139 (+) | 483 | WP_127087968.1 | hypothetical protein | - |
| C5E18_RS12030 (C5E18_12090) | - | 2504123..2504596 (+) | 474 | WP_127087969.1 | hypothetical protein | - |
| C5E18_RS12035 (C5E18_12095) | - | 2504593..2504985 (+) | 393 | WP_127087970.1 | NlpC/P60 family protein | - |
| C5E18_RS12040 (C5E18_12100) | - | 2504972..2507488 (+) | 2517 | WP_127087971.1 | host specificity factor TipJ family phage tail protein | - |
| C5E18_RS12045 (C5E18_12105) | - | 2507555..2509909 (+) | 2355 | WP_127087972.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 150 a.a. Molecular weight: 16593.56 Da Isoelectric Point: 5.7829
>NTDB_id=276141 C5E18_RS11715 WP_127087911.1 2464905..2465357(-) (ssb) [Pectobacterium parmentieri strain IFB5427]
MGQRGVNKVILVGHLGQDPEVRYMPNGGAVANITLATSESWRDKQTGEQKEKTEWHRVVLFGKLAEVAGEYLRKGSQVYI
EGALQTRKWADQSGVERYTTEVVVNVGGIMQMLGGKQDGGQQQPKGNGRQQQPPAQNNEPPMDFDDEPPF
MGQRGVNKVILVGHLGQDPEVRYMPNGGAVANITLATSESWRDKQTGEQKEKTEWHRVVLFGKLAEVAGEYLRKGSQVYI
EGALQTRKWADQSGVERYTTEVVVNVGGIMQMLGGKQDGGQQQPKGNGRQQQPPAQNNEPPMDFDDEPPF
Nucleotide
Download Length: 453 bp
>NTDB_id=276141 C5E18_RS11715 WP_127087911.1 2464905..2465357(-) (ssb) [Pectobacterium parmentieri strain IFB5427]
ATGGGACAGAGAGGCGTCAACAAAGTAATTCTTGTCGGACATTTGGGTCAAGACCCGGAAGTCCGCTATATGCCGAATGG
TGGTGCAGTTGCCAACATCACGCTGGCTACGTCGGAAAGCTGGCGTGACAAGCAAACCGGTGAGCAGAAAGAGAAGACCG
AATGGCACCGTGTGGTTCTGTTCGGCAAACTGGCAGAAGTTGCAGGCGAATACCTGCGCAAAGGCTCTCAGGTTTATATC
GAAGGCGCACTACAAACCCGTAAGTGGGCCGATCAGTCTGGTGTAGAGCGTTACACCACTGAAGTGGTCGTTAATGTCGG
TGGCATCATGCAGATGCTTGGTGGCAAGCAGGATGGCGGGCAGCAACAACCAAAGGGCAATGGGCGACAACAGCAACCAC
CAGCGCAAAATAATGAGCCTCCGATGGATTTCGACGACGAGCCACCATTCTGA
ATGGGACAGAGAGGCGTCAACAAAGTAATTCTTGTCGGACATTTGGGTCAAGACCCGGAAGTCCGCTATATGCCGAATGG
TGGTGCAGTTGCCAACATCACGCTGGCTACGTCGGAAAGCTGGCGTGACAAGCAAACCGGTGAGCAGAAAGAGAAGACCG
AATGGCACCGTGTGGTTCTGTTCGGCAAACTGGCAGAAGTTGCAGGCGAATACCTGCGCAAAGGCTCTCAGGTTTATATC
GAAGGCGCACTACAAACCCGTAAGTGGGCCGATCAGTCTGGTGTAGAGCGTTACACCACTGAAGTGGTCGTTAATGTCGG
TGGCATCATGCAGATGCTTGGTGGCAAGCAGGATGGCGGGCAGCAACAACCAAAGGGCAATGGGCGACAACAGCAACCAC
CAGCGCAAAATAATGAGCCTCCGATGGATTTCGACGACGAGCCACCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
65.537 |
100 |
0.773 |
| ssb | Glaesserella parasuis strain SC1401 |
50.276 |
100 |
0.607 |
| ssb | Neisseria meningitidis MC58 |
46.98 |
99.333 |
0.467 |
| ssb | Neisseria gonorrhoeae MS11 |
46.98 |
99.333 |
0.467 |