Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | C6N18_RS17180 | Genome accession | NZ_CP027246 |
| Coordinates | 3364743..3365096 (+) | Length | 117 a.a. |
| NCBI ID | WP_002014678.1 | Uniprot ID | A0A0D5YEH0 |
| Organism | Acinetobacter baumannii strain WCHAB005078 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3336126..3367462 | 3364743..3365096 | within | 0 |
Gene organization within MGE regions
Location: 3336126..3367462
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C6N18_RS16990 (C6N18_17010) | - | 3336126..3337124 (-) | 999 | WP_001284079.1 | phage portal protein | - |
| C6N18_RS16995 (C6N18_17015) | - | 3337124..3338911 (-) | 1788 | WP_031946558.1 | terminase large subunit domain-containing protein | - |
| C6N18_RS17000 (C6N18_17020) | - | 3339070..3339897 (+) | 828 | WP_000748563.1 | GPO family capsid scaffolding protein | - |
| C6N18_RS17005 (C6N18_17025) | - | 3339950..3340939 (+) | 990 | WP_001243259.1 | phage major capsid protein, P2 family | - |
| C6N18_RS17010 (C6N18_17030) | gpM | 3340950..3341696 (+) | 747 | WP_000950641.1 | phage terminase small subunit | - |
| C6N18_RS17015 (C6N18_17035) | - | 3341800..3342252 (+) | 453 | WP_000015691.1 | head completion/stabilization protein | - |
| C6N18_RS17020 (C6N18_17040) | - | 3342253..3342462 (+) | 210 | WP_000659474.1 | tail protein X | - |
| C6N18_RS17025 (C6N18_17045) | - | 3342471..3342821 (+) | 351 | WP_001114936.1 | putative holin | - |
| C6N18_RS17030 (C6N18_17050) | - | 3342818..3343087 (+) | 270 | WP_000571491.1 | phage holin family protein | - |
| C6N18_RS17035 (C6N18_17055) | - | 3343084..3343914 (+) | 831 | WP_000600982.1 | N-acetylmuramidase domain-containing protein | - |
| C6N18_RS17040 (C6N18_17060) | - | 3343911..3344438 (+) | 528 | WP_000742888.1 | phage tail protein | - |
| C6N18_RS17045 (C6N18_17065) | - | 3344435..3344884 (+) | 450 | WP_001059843.1 | phage virion morphogenesis protein | - |
| C6N18_RS17050 (C6N18_17070) | - | 3344957..3345589 (+) | 633 | WP_000990625.1 | phage baseplate assembly protein V | - |
| C6N18_RS17055 (C6N18_17075) | - | 3345586..3345933 (+) | 348 | WP_000987745.1 | GPW/gp25 family protein | - |
| C6N18_RS17060 (C6N18_17080) | - | 3345930..3346832 (+) | 903 | WP_000109738.1 | baseplate J/gp47 family protein | - |
| C6N18_RS17065 (C6N18_17085) | - | 3346832..3347437 (+) | 606 | WP_001050805.1 | phage tail protein I | - |
| C6N18_RS17070 (C6N18_17090) | - | 3347449..3349401 (+) | 1953 | WP_000729646.1 | phage tail protein | - |
| C6N18_RS17075 (C6N18_17095) | - | 3349551..3350726 (+) | 1176 | WP_000963361.1 | phage tail sheath protein | - |
| C6N18_RS17080 (C6N18_17100) | - | 3350739..3351257 (+) | 519 | WP_001207612.1 | phage major tail tube protein | - |
| C6N18_RS17085 (C6N18_17105) | - | 3351324..3351665 (+) | 342 | WP_001071615.1 | phage tail assembly protein | - |
| C6N18_RS17090 (C6N18_17110) | - | 3351710..3351805 (+) | 96 | WP_236085181.1 | GpE family phage tail protein | - |
| C6N18_RS17095 (C6N18_17115) | - | 3351819..3354269 (+) | 2451 | WP_000774268.1 | phage tail tape measure protein | - |
| C6N18_RS17100 (C6N18_17120) | - | 3354275..3354715 (+) | 441 | WP_000979757.1 | phage tail protein | - |
| C6N18_RS17105 (C6N18_17125) | - | 3354716..3356029 (+) | 1314 | WP_000483061.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| C6N18_RS17110 (C6N18_17130) | - | 3356159..3356398 (+) | 240 | WP_000113725.1 | ogr/Delta-like zinc finger family protein | - |
| C6N18_RS17115 (C6N18_17135) | - | 3356395..3356595 (+) | 201 | WP_000130085.1 | TraR/DksA C4-type zinc finger protein | - |
| C6N18_RS17125 (C6N18_17145) | - | 3356911..3357192 (-) | 282 | WP_000713873.1 | hypothetical protein | - |
| C6N18_RS17130 (C6N18_17150) | - | 3357192..3358070 (-) | 879 | WP_000417952.1 | BRCT domain-containing protein | - |
| C6N18_RS17135 (C6N18_17160) | - | 3358380..3358574 (+) | 195 | WP_000696053.1 | hypothetical protein | - |
| C6N18_RS17140 (C6N18_17165) | - | 3358682..3359497 (+) | 816 | WP_001094886.1 | Rha family transcriptional regulator | - |
| C6N18_RS17145 (C6N18_17170) | - | 3359622..3359837 (+) | 216 | WP_000556351.1 | hypothetical protein | - |
| C6N18_RS17150 (C6N18_17175) | - | 3359882..3360223 (-) | 342 | WP_000786719.1 | helix-turn-helix domain-containing protein | - |
| C6N18_RS17155 (C6N18_17180) | - | 3360316..3360507 (+) | 192 | WP_001043481.1 | hypothetical protein | - |
| C6N18_RS17160 (C6N18_17185) | - | 3360601..3363339 (+) | 2739 | WP_002014340.1 | toprim domain-containing protein | - |
| C6N18_RS17165 (C6N18_17190) | - | 3363336..3363668 (+) | 333 | WP_000632296.1 | hypothetical protein | - |
| C6N18_RS17170 (C6N18_17195) | - | 3363734..3364285 (+) | 552 | WP_001178668.1 | hypothetical protein | - |
| C6N18_RS20565 | - | 3364275..3364445 (+) | 171 | WP_001015076.1 | hypothetical protein | - |
| C6N18_RS17175 (C6N18_17200) | - | 3364438..3364755 (+) | 318 | WP_000049658.1 | hypothetical protein | - |
| C6N18_RS17180 (C6N18_17205) | ssb | 3364743..3365096 (+) | 354 | WP_002014678.1 | single-stranded DNA-binding protein | Machinery gene |
| C6N18_RS17185 (C6N18_17210) | - | 3365106..3365843 (+) | 738 | WP_000125747.1 | 3'-5' exonuclease | - |
| C6N18_RS17190 (C6N18_17215) | - | 3365853..3366074 (+) | 222 | WP_000424605.1 | hypothetical protein | - |
| C6N18_RS17195 (C6N18_17220) | - | 3366071..3366367 (+) | 297 | WP_000218943.1 | hypothetical protein | - |
| C6N18_RS17200 (C6N18_17225) | - | 3366395..3367462 (-) | 1068 | WP_000107854.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 117 a.a. Molecular weight: 13365.13 Da Isoelectric Point: 9.7939
>NTDB_id=275994 C6N18_RS17180 WP_002014678.1 3364743..3365096(+) (ssb) [Acinetobacter baumannii strain WCHAB005078]
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
Nucleotide
Download Length: 354 bp
>NTDB_id=275994 C6N18_RS17180 WP_002014678.1 3364743..3365096(+) (ssb) [Acinetobacter baumannii strain WCHAB005078]
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
55.455 |
94.017 |
0.521 |
| ssb | Vibrio cholerae strain A1552 |
54.545 |
84.615 |
0.462 |
| ssb | Neisseria gonorrhoeae MS11 |
42.857 |
89.744 |
0.385 |
| ssb | Neisseria meningitidis MC58 |
42.857 |
89.744 |
0.385 |