Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | MC81_RS03540 | Genome accession | NZ_CP026973 |
| Coordinates | 755398..755901 (-) | Length | 167 a.a. |
| NCBI ID | WP_104653353.1 | Uniprot ID | - |
| Organism | Achromobacter insolitus strain FDAARGOS_88 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 750295..792642 | 755398..755901 | within | 0 |
Gene organization within MGE regions
Location: 750295..792642
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MC81_RS03500 (MC81_03500) | - | 750295..751536 (-) | 1242 | WP_042792896.1 | integrase arm-type DNA-binding domain-containing protein | - |
| MC81_RS03505 (MC81_03505) | - | 751549..751806 (-) | 258 | WP_223306439.1 | AlpA family transcriptional regulator | - |
| MC81_RS03510 (MC81_03510) | - | 751806..752102 (-) | 297 | WP_042792897.1 | ASCH domain-containing protein | - |
| MC81_RS03515 (MC81_03515) | - | 752095..752727 (-) | 633 | WP_104653351.1 | hypothetical protein | - |
| MC81_RS03520 (MC81_03520) | - | 752720..753598 (-) | 879 | WP_042792900.1 | hypothetical protein | - |
| MC81_RS03525 (MC81_03525) | - | 753595..753936 (-) | 342 | WP_042792901.1 | hypothetical protein | - |
| MC81_RS03530 (MC81_03530) | - | 753936..754199 (-) | 264 | WP_104653352.1 | hypothetical protein | - |
| MC81_RS32665 | - | 754199..754660 (-) | 462 | WP_223306440.1 | hypothetical protein | - |
| MC81_RS32270 | - | 754746..755381 (+) | 636 | WP_146099957.1 | hypothetical protein | - |
| MC81_RS03540 (MC81_03540) | ssb | 755398..755901 (-) | 504 | WP_104653353.1 | single-stranded DNA-binding protein | Machinery gene |
| MC81_RS03545 (MC81_03545) | - | 755901..756536 (-) | 636 | WP_104653354.1 | lambda exonuclease family protein | - |
| MC81_RS03550 (MC81_03550) | - | 756536..757315 (-) | 780 | WP_104653355.1 | ERF family protein | - |
| MC81_RS03555 (MC81_03555) | - | 757323..758420 (-) | 1098 | WP_042792904.1 | hypothetical protein | - |
| MC81_RS03560 (MC81_03560) | - | 758422..758613 (-) | 192 | WP_042792905.1 | hypothetical protein | - |
| MC81_RS03565 (MC81_03565) | - | 758610..759029 (-) | 420 | WP_104653356.1 | hypothetical protein | - |
| MC81_RS03570 (MC81_03570) | - | 759186..759554 (-) | 369 | WP_042792906.1 | hypothetical protein | - |
| MC81_RS03575 (MC81_03575) | - | 759558..759950 (-) | 393 | WP_042792907.1 | hypothetical protein | - |
| MC81_RS03580 (MC81_03580) | - | 760810..761466 (+) | 657 | WP_042792908.1 | hypothetical protein | - |
| MC81_RS03585 (MC81_03585) | - | 761539..762027 (-) | 489 | WP_042792909.1 | hypothetical protein | - |
| MC81_RS03590 (MC81_03590) | - | 762024..762350 (-) | 327 | WP_223306441.1 | STAS-like domain-containing protein | - |
| MC81_RS32275 | - | 762325..763212 (-) | 888 | WP_146099958.1 | hypothetical protein | - |
| MC81_RS32280 (MC81_03600) | - | 763433..764533 (-) | 1101 | WP_104653357.1 | S24 family peptidase | - |
| MC81_RS03605 (MC81_03605) | - | 764616..764870 (+) | 255 | WP_190278644.1 | YdaS family helix-turn-helix protein | - |
| MC81_RS32470 | - | 764873..765037 (-) | 165 | WP_190278645.1 | hypothetical protein | - |
| MC81_RS03610 (MC81_03610) | - | 765076..765390 (+) | 315 | WP_042792911.1 | CII family transcriptional regulator | - |
| MC81_RS03615 (MC81_03615) | - | 765392..765913 (+) | 522 | WP_042792912.1 | DUF1367 family protein | - |
| MC81_RS03620 (MC81_03620) | - | 765910..766371 (+) | 462 | WP_042792913.1 | nuclease domain-containing protein | - |
| MC81_RS03625 (MC81_03625) | - | 766361..767209 (+) | 849 | WP_104653359.1 | hypothetical protein | - |
| MC81_RS03630 (MC81_03630) | - | 767247..767879 (+) | 633 | WP_317629784.1 | hypothetical protein | - |
| MC81_RS03635 (MC81_03635) | - | 767876..768415 (+) | 540 | WP_223306442.1 | hypothetical protein | - |
| MC81_RS03640 (MC81_03640) | - | 768415..768615 (+) | 201 | WP_042792915.1 | hypothetical protein | - |
| MC81_RS03645 (MC81_03645) | - | 768608..768964 (+) | 357 | WP_042792916.1 | hypothetical protein | - |
| MC81_RS03650 (MC81_03650) | - | 768961..769263 (+) | 303 | WP_042792917.1 | hypothetical protein | - |
| MC81_RS03655 (MC81_03655) | - | 769335..769652 (-) | 318 | WP_042792918.1 | hypothetical protein | - |
| MC81_RS03660 (MC81_03660) | - | 769884..770303 (+) | 420 | WP_042792919.1 | terminase small subunit | - |
| MC81_RS03665 (MC81_03665) | - | 770332..771528 (+) | 1197 | WP_223306527.1 | PBSX family phage terminase large subunit | - |
| MC81_RS03670 (MC81_03670) | - | 771525..773033 (+) | 1509 | WP_042792920.1 | DUF1073 domain-containing protein | - |
| MC81_RS03675 (MC81_03675) | - | 773062..773805 (+) | 744 | WP_223306443.1 | minor capsid protein | - |
| MC81_RS03680 (MC81_03680) | - | 773786..775042 (+) | 1257 | WP_042792921.1 | DUF2213 domain-containing protein | - |
| MC81_RS03685 (MC81_03685) | - | 775039..775521 (+) | 483 | WP_042792922.1 | phage minor capsid protein | - |
| MC81_RS03690 (MC81_03690) | - | 775540..776622 (+) | 1083 | WP_042792923.1 | major capsid family protein | - |
| MC81_RS03695 (MC81_03695) | - | 776682..777032 (+) | 351 | WP_042792924.1 | hypothetical protein | - |
| MC81_RS03700 (MC81_03700) | - | 777034..777462 (+) | 429 | WP_104653361.1 | DUF4054 domain-containing protein | - |
| MC81_RS03705 (MC81_03705) | - | 777459..777935 (+) | 477 | WP_042792925.1 | hypothetical protein | - |
| MC81_RS03710 (MC81_03710) | - | 777932..778300 (+) | 369 | WP_104653362.1 | phage collar protein | - |
| MC81_RS03715 (MC81_03715) | - | 778297..778824 (+) | 528 | WP_042792926.1 | phage gateway protein | - |
| MC81_RS03720 (MC81_03720) | - | 778835..780343 (+) | 1509 | WP_042792927.1 | DUF3383 domain-containing protein | - |
| MC81_RS03725 (MC81_03725) | - | 780401..780850 (+) | 450 | WP_042792928.1 | phage tail fiber protein | - |
| MC81_RS03730 (MC81_03730) | - | 780860..781315 (+) | 456 | WP_042792930.1 | hypothetical protein | - |
| MC81_RS03735 (MC81_03735) | - | 781406..783238 (+) | 1833 | WP_042792931.1 | phage tail tape measure protein | - |
| MC81_RS03740 (MC81_03740) | - | 783238..783768 (+) | 531 | WP_104653363.1 | phage baseplate protein | - |
| MC81_RS03745 (MC81_03745) | - | 783765..784073 (+) | 309 | WP_042792932.1 | hypothetical protein | - |
| MC81_RS03750 (MC81_03750) | - | 784066..784890 (+) | 825 | WP_042792933.1 | baseplate hub protein | - |
| MC81_RS03755 (MC81_03755) | - | 784875..785561 (+) | 687 | WP_042792934.1 | Gp138 family membrane-puncturing spike protein | - |
| MC81_RS03760 (MC81_03760) | - | 785558..785902 (+) | 345 | WP_042792935.1 | hypothetical protein | - |
| MC81_RS03765 (MC81_03765) | - | 785895..787085 (+) | 1191 | WP_042792936.1 | baseplate J/gp47 family protein | - |
| MC81_RS03770 (MC81_03770) | - | 787082..787732 (+) | 651 | WP_042792937.1 | DUF2612 domain-containing protein | - |
| MC81_RS32955 (MC81_03775) | - | 787733..788773 (+) | 1041 | WP_104653364.1 | glycine-rich domain-containing protein | - |
| MC81_RS03780 (MC81_03780) | - | 788776..789162 (+) | 387 | WP_104653365.1 | tail fiber assembly protein | - |
| MC81_RS03785 (MC81_03785) | - | 789226..789516 (+) | 291 | WP_042792938.1 | holin | - |
| MC81_RS03790 (MC81_03790) | - | 789513..789923 (+) | 411 | WP_042792939.1 | M15 family metallopeptidase | - |
| MC81_RS03795 (MC81_03795) | - | 789920..790426 (+) | 507 | WP_104653366.1 | lysis system i-spanin subunit Rz | - |
| MC81_RS32290 | - | 790457..791128 (-) | 672 | WP_146099959.1 | hypothetical protein | - |
| MC81_RS33000 (MC81_03800) | - | 791360..791584 (-) | 225 | WP_104653367.1 | CrpP-related protein | - |
| MC81_RS03805 (MC81_03805) | - | 791682..791900 (-) | 219 | WP_104653368.1 | hypothetical protein | - |
| MC81_RS03810 (MC81_03810) | - | 791950..792642 (-) | 693 | WP_042792941.1 | SOS response-associated peptidase | - |
Sequence
Protein
Download Length: 167 a.a. Molecular weight: 18294.17 Da Isoelectric Point: 5.3459
>NTDB_id=274083 MC81_RS03540 WP_104653353.1 755398..755901(-) (ssb) [Achromobacter insolitus strain FDAARGOS_88]
MASVNKVILVGNLGRDPDVRYSPDGAAICNISLATTSSWKDKASGEKREETEWHRVVIYGRVAEIAGEYLKKGRSVYLEG
RLKTRKWQDKDTGADRYSTEVIADQMQMLGGRDESGSGGYDDAPRQPGAPAQRQAPRNNEYANQRSGSAPQSAPSANLAD
MDDDIPF
MASVNKVILVGNLGRDPDVRYSPDGAAICNISLATTSSWKDKASGEKREETEWHRVVIYGRVAEIAGEYLKKGRSVYLEG
RLKTRKWQDKDTGADRYSTEVIADQMQMLGGRDESGSGGYDDAPRQPGAPAQRQAPRNNEYANQRSGSAPQSAPSANLAD
MDDDIPF
Nucleotide
Download Length: 504 bp
>NTDB_id=274083 MC81_RS03540 WP_104653353.1 755398..755901(-) (ssb) [Achromobacter insolitus strain FDAARGOS_88]
ATGGCCAGCGTCAACAAAGTCATCCTGGTGGGCAACCTGGGCCGCGACCCCGACGTCCGCTACAGCCCCGACGGCGCGGC
CATCTGCAACATTTCCCTGGCCACGACTTCCAGCTGGAAGGACAAGGCCAGCGGAGAAAAGCGCGAAGAGACAGAATGGC
ACCGCGTTGTGATCTACGGGCGCGTGGCCGAGATCGCCGGCGAGTACCTGAAGAAAGGTCGCTCCGTCTATCTGGAAGGC
CGACTCAAGACGAGGAAATGGCAAGACAAGGACACAGGTGCTGACCGCTACAGCACCGAAGTCATTGCGGACCAGATGCA
GATGCTAGGCGGCCGCGATGAGAGCGGAAGCGGTGGCTACGACGATGCACCGCGCCAGCCGGGCGCGCCGGCGCAACGCC
AAGCACCGCGGAACAACGAGTACGCCAACCAACGCAGCGGATCCGCACCGCAATCGGCCCCGTCGGCCAACCTGGCCGAC
ATGGATGACGATATCCCGTTCTAA
ATGGCCAGCGTCAACAAAGTCATCCTGGTGGGCAACCTGGGCCGCGACCCCGACGTCCGCTACAGCCCCGACGGCGCGGC
CATCTGCAACATTTCCCTGGCCACGACTTCCAGCTGGAAGGACAAGGCCAGCGGAGAAAAGCGCGAAGAGACAGAATGGC
ACCGCGTTGTGATCTACGGGCGCGTGGCCGAGATCGCCGGCGAGTACCTGAAGAAAGGTCGCTCCGTCTATCTGGAAGGC
CGACTCAAGACGAGGAAATGGCAAGACAAGGACACAGGTGCTGACCGCTACAGCACCGAAGTCATTGCGGACCAGATGCA
GATGCTAGGCGGCCGCGATGAGAGCGGAAGCGGTGGCTACGACGATGCACCGCGCCAGCCGGGCGCGCCGGCGCAACGCC
AAGCACCGCGGAACAACGAGTACGCCAACCAACGCAGCGGATCCGCACCGCAATCGGCCCCGTCGGCCAACCTGGCCGAC
ATGGATGACGATATCCCGTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
53.371 |
100 |
0.569 |
| ssb | Glaesserella parasuis strain SC1401 |
47.514 |
100 |
0.515 |
| ssb | Neisseria gonorrhoeae MS11 |
48.295 |
100 |
0.509 |
| ssb | Neisseria meningitidis MC58 |
47.727 |
100 |
0.503 |