Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   C5B79_RS00030 Genome accession   NZ_CP026784
Coordinates   4771..5307 (+) Length   178 a.a.
NCBI ID   WP_000168299.1    Uniprot ID   Q327X2
Organism   Shigella dysenteriae strain 80-547     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 36..48864 4771..5307 within 0
IScluster/Tn 6049..42836 4771..5307 flank 742


Gene organization within MGE regions


Location: 36..48864
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C5B79_RS00010 aphA 575..773 (+) 199 Protein_1 acid phosphatase AphA -
  C5B79_RS00015 - 884..1300 (+) 417 WP_000270375.1 secondary thiamine-phosphate synthase enzyme YjbQ -
  C5B79_RS00020 - 1304..1660 (+) 357 WP_000155657.1 MmcQ/YjbR family DNA-binding protein -
  C5B79_RS00025 uvrA 1695..4517 (-) 2823 WP_000357751.1 excinuclease ABC subunit UvrA -
  C5B79_RS00030 ssb 4771..5307 (+) 537 WP_000168299.1 single-stranded DNA-binding protein SSB1 Machinery gene
  C5B79_RS00035 - 5406..5687 (-) 282 WP_005021204.1 YjcB family protein -
  C5B79_RS00045 - 6797..7009 (+) 213 Protein_8 EAL domain-containing protein -
  C5B79_RS00050 soxS 7012..7335 (-) 324 WP_000019351.1 superoxide response transcriptional regulator SoxS -
  C5B79_RS00055 soxR 7421..7885 (+) 465 WP_000412428.1 redox-sensitive transcriptional activator SoxR -
  C5B79_RS00060 ghxP 8432..9781 (+) 1350 WP_000106882.1 guanine/hypoxanthine transporter GhxP -
  C5B79_RS00065 - 9932..11581 (+) 1650 WP_000402207.1 Na+/H+ antiporter -
  C5B79_RS00075 - 12719..12847 (-) 129 Protein_14 integrase -
  C5B79_RS00080 - 12828..14047 (-) 1220 Protein_15 IS3-like element IS600 family transposase -
  C5B79_RS00085 - 14115..14489 (+) 375 Protein_16 DUF4942 domain-containing protein -
  C5B79_RS00100 - 15765..16458 (+) 694 Protein_18 IS1 family transposase -
  C5B79_RS00105 - 16579..17759 (+) 1181 Protein_19 sugar efflux transporter -
  C5B79_RS00115 - 17870..18793 (+) 924 WP_000535937.1 carboxylate/amino acid/amine transporter -
  C5B79_RS00120 nlpA 18797..19615 (-) 819 WP_000779403.1 lipoprotein NlpA -
  C5B79_RS00135 - 21315..21962 (+) 648 Protein_24 DNA helicase -
  C5B79_RS00140 - 22007..22897 (-) 891 Protein_25 IS3-like element IS600 family transposase -
  C5B79_RS00155 - 23744..24154 (-) 411 WP_001066413.1 transposase -
  C5B79_RS00160 tnpB 24174..24510 (-) 337 Protein_28 IS66 family insertion sequence element accessory protein TnpB -
  C5B79_RS00165 tnpA 24507..25181 (-) 675 WP_005021247.1 IS66-like element accessory protein TnpA -
  C5B79_RS00175 tnpB 25557..25904 (+) 348 WP_000612546.1 IS66 family insertion sequence element accessory protein TnpB -
  C5B79_RS00180 - 25954..27492 (+) 1539 WP_000998102.1 IS66-like element ISEc8 family transposase -
  C5B79_RS27615 - 27531..27596 (+) 66 Protein_32 hypothetical protein -
  C5B79_RS00185 evgS 27652..31245 (-) 3594 WP_024259479.1 acid-sensing system histidine kinase EvgS -
  C5B79_RS00190 evgA 31250..31864 (-) 615 WP_000991370.1 acid-sensing system DNA-binding response regulator EvgA -
  C5B79_RS00195 - 32238..32935 (+) 698 Protein_35 IS1 family transposase -
  C5B79_RS27620 - 32946..33008 (-) 63 WP_113705808.1 hypothetical protein -
  C5B79_RS00210 - 34590..34694 (+) 105 Protein_38 IS3 family transposase -
  C5B79_RS00225 - 36021..36714 (-) 694 Protein_40 IS1 family transposase -
  C5B79_RS26810 - 36964..37100 (-) 137 Protein_41 IS5/IS1182 family transposase -
  C5B79_RS00240 - 37177..37308 (-) 132 Protein_42 IS3 family transposase -
  C5B79_RS00245 yacB 37366..37494 (-) 129 Protein_43 type II toxin-antitoxin system toxin YacB -
  C5B79_RS00250 - 37530..38192 (-) 663 Protein_44 IS256 family transposase -
  C5B79_RS00260 tnpA 39384..39846 (-) 463 Protein_46 IS200/IS605 family transposase -
  C5B79_RS00270 - 40252..40428 (-) 177 WP_000255685.1 hypothetical protein -
  C5B79_RS00275 - 40828..41613 (-) 786 Protein_48 IS3 family transposase -
  C5B79_RS00280 - 41680..42836 (+) 1157 Protein_49 IS3-like element IS600 family transposase -
  C5B79_RS00285 lysS 42876..43052 (-) 177 Protein_50 lysine--tRNA ligase -
  C5B79_RS00290 dtpC 43289..44746 (-) 1458 WP_000856800.1 dipeptide/tripeptide permease DtpC -
  C5B79_RS00295 cadA 44805..46946 (-) 2142 Protein_52 lysine decarboxylase CadA -
  C5B79_RS00300 cadB 47026..48111 (-) 1086 Protein_53 cadaverine/lysine antiporter -
  C5B79_RS00305 - 48170..48864 (+) 695 WP_087786203.1 IS1-like element IS1N family transposase -

Sequence


Protein


Download         Length: 178 a.a.        Molecular weight: 18991.04 Da        Isoelectric Point: 5.2358

>NTDB_id=272489 C5B79_RS00030 WP_000168299.1 4771..5307(+) (ssb) [Shigella dysenteriae strain 80-547]
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYI
EGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQLQGGWGQPQQPQGGNQFSGGAQSRPQQSA
PAAPSNEPPMDFDDDIPF

Nucleotide


Download         Length: 537 bp        

>NTDB_id=272489 C5B79_RS00030 WP_000168299.1 4771..5307(+) (ssb) [Shigella dysenteriae strain 80-547]
ATGGCCAGCAGAGGCGTAAACAAGGTTATTCTCGTTGGTAATCTGGGTCAGGACCCGGAAGTACGCTACATGCCAAATGG
TGGCGCAGTTGCCAACATTACGCTGGCTACTTCCGAATCCTGGCGTGATAAAGCGACCGGCGAGATGAAAGAGCAGACTG
AATGGCACCGCGTTGTGCTGTTCGGCAAACTGGCAGAAGTGGCCAGCGAATATCTGCGTAAAGGTTCTCAGGTTTATATC
GAAGGTCAGCTGCGTACCCGTAAATGGACCGATCAATCCGGTCAGGATCGCTACACCACAGAAGTTGTGGTGAACGTTGG
CGGCACTATGCAGATGCTGGGTGGTCGTCAGGGTGGTGGCGCTCCTGCAGGTGGCAATATCGGTGGTGGTCAGCTGCAGG
GCGGTTGGGGTCAGCCTCAGCAGCCGCAGGGTGGCAATCAGTTCAGCGGCGGCGCGCAGTCTCGCCCGCAGCAGTCCGCT
CCGGCAGCGCCGTCTAACGAGCCGCCGATGGACTTTGATGATGACATTCCGTTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q327X2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

74.444

100

0.753

  ssb Glaesserella parasuis strain SC1401

57.923

100

0.596

  ssb Neisseria meningitidis MC58

48.066

100

0.489

  ssb Neisseria gonorrhoeae MS11

48.066

100

0.489


Multiple sequence alignment