Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   C1P63_RS22375 Genome accession   NZ_CP026780
Coordinates   4077282..4077818 (-) Length   178 a.a.
NCBI ID   WP_000168299.1    Uniprot ID   Q327X2
Organism   Shigella dysenteriae strain 53-3937     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 4038485..4108734 4077282..4077818 within 0
IScluster/Tn 4075846..4076540 4077282..4077818 flank 742


Gene organization within MGE regions


Location: 4038485..4108734
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C1P63_RS22120 - 4038485..4039641 (-) 1157 Protein_4194 IS3-like element IS600 family transposase -
  C1P63_RS22125 - 4039708..4040493 (+) 786 Protein_4195 IS3 family transposase -
  C1P63_RS25740 - 4040893..4041069 (+) 177 WP_000255685.1 hypothetical protein -
  C1P63_RS22140 tnpA 4041475..4041937 (+) 463 Protein_4197 IS200/IS605 family transposase -
  C1P63_RS22145 - 4042411..4043105 (+) 695 WP_134801557.1 IS1-like element IS1N family transposase -
  C1P63_RS22150 - 4043129..4043791 (+) 663 Protein_4199 IS256 family transposase -
  C1P63_RS22155 yacB 4043827..4043955 (+) 129 Protein_4200 type II toxin-antitoxin system toxin YacB -
  C1P63_RS22160 - 4044013..4044144 (+) 132 Protein_4201 IS3 family transposase -
  C1P63_RS26275 - 4044221..4044357 (+) 137 Protein_4202 IS5/IS1182 family transposase -
  C1P63_RS22175 - 4044607..4045300 (+) 694 Protein_4203 IS1 family transposase -
  C1P63_RS22180 - 4045425..4046122 (+) 698 WP_228769498.1 IS1-like element IS1SD family transposase -
  C1P63_RS22190 - 4046627..4046731 (-) 105 Protein_4205 IS3 family transposase -
  C1P63_RS22195 - 4046931..4048159 (+) 1229 WP_171764072.1 IS3-like element IS2 family transposase -
  C1P63_RS22200 - 4048313..4048375 (+) 63 WP_113705808.1 hypothetical protein -
  C1P63_RS22205 - 4048386..4049083 (-) 698 Protein_4208 IS1 family transposase -
  C1P63_RS22210 evgA 4049457..4050070 (+) 614 Protein_4209 acid-sensing system DNA-binding response regulator EvgA -
  C1P63_RS22215 evgS 4050075..4053668 (+) 3594 WP_134806299.1 acid-sensing system histidine kinase EvgS -
  C1P63_RS26600 - 4053724..4053789 (-) 66 Protein_4211 hypothetical protein -
  C1P63_RS22220 - 4053828..4055366 (-) 1539 WP_000998102.1 IS66-like element ISEc8 family transposase -
  C1P63_RS22225 tnpB 4055416..4055763 (-) 348 WP_000612546.1 IS66 family insertion sequence element accessory protein TnpB -
  C1P63_RS22235 tnpA 4056139..4056813 (+) 675 WP_005021247.1 IS66-like element accessory protein TnpA -
  C1P63_RS22240 tnpB 4056810..4057146 (+) 337 Protein_4215 IS66 family insertion sequence element accessory protein TnpB -
  C1P63_RS22245 - 4057166..4057576 (+) 411 WP_001066413.1 transposase -
  C1P63_RS22255 - 4057708..4058405 (+) 698 WP_134795416.1 IS1-like element IS1SD family transposase -
  C1P63_RS22260 - 4058423..4059313 (+) 891 Protein_4218 IS3-like element IS600 family transposase -
  C1P63_RS22265 - 4059358..4060005 (-) 648 Protein_4219 DNA helicase -
  C1P63_RS22270 - 4060065..4060759 (+) 695 WP_134801567.1 IS1-like element IS1N family transposase -
  C1P63_RS22275 - 4060871..4061914 (-) 1044 WP_000999849.1 tetratricopeptide repeat protein -
  C1P63_RS22285 - 4063099..4063227 (-) 129 Protein_4223 integrase -
  C1P63_RS22290 - 4063208..4064427 (-) 1220 Protein_4224 IS3-like element IS600 family transposase -
  C1P63_RS22295 - 4064495..4064869 (+) 375 Protein_4225 DUF4942 domain-containing protein -
  C1P63_RS22310 - 4066145..4066838 (+) 694 Protein_4227 IS1 family transposase -
  C1P63_RS22315 - 4066959..4068139 (+) 1181 Protein_4228 sugar efflux transporter -
  C1P63_RS22325 - 4068250..4069173 (+) 924 WP_000535937.1 carboxylate/amino acid/amine transporter -
  C1P63_RS22330 nlpA 4069177..4069995 (-) 819 WP_000779403.1 lipoprotein NlpA -
  C1P63_RS22340 - 4071008..4072657 (-) 1650 WP_000402207.1 Na+/H+ antiporter -
  C1P63_RS22345 ghxP 4072808..4074157 (-) 1350 WP_000106882.1 guanine/hypoxanthine transporter GhxP -
  C1P63_RS22350 soxR 4074704..4075168 (-) 465 WP_000412428.1 redox-sensitive transcriptional activator SoxR -
  C1P63_RS22355 soxS 4075254..4075577 (+) 324 WP_000019351.1 superoxide response transcriptional regulator SoxS -
  C1P63_RS22360 - 4075580..4075792 (-) 213 Protein_4236 EAL domain-containing protein -
  C1P63_RS22365 - 4075846..4076540 (+) 695 WP_134801565.1 IS1-like element IS1N family transposase -
  C1P63_RS22370 - 4076902..4077183 (+) 282 WP_005021204.1 YjcB family protein -
  C1P63_RS22375 ssb 4077282..4077818 (-) 537 WP_000168299.1 single-stranded DNA-binding protein SSB1 Machinery gene
  C1P63_RS22380 uvrA 4078072..4080893 (+) 2822 Protein_4240 excinuclease ABC subunit UvrA -
  C1P63_RS22385 - 4080928..4081284 (-) 357 WP_000155657.1 MmcQ/YjbR family DNA-binding protein -
  C1P63_RS22390 - 4081288..4081704 (-) 417 WP_000270375.1 secondary thiamine-phosphate synthase enzyme YjbQ -
  C1P63_RS22395 aphA 4081815..4082013 (-) 199 Protein_4243 acid phosphatase AphA -
  C1P63_RS22405 aphA 4082779..4083300 (-) 522 Protein_4245 acid phosphatase AphA -
  C1P63_RS22415 - 4083528..4084221 (+) 694 Protein_4246 IS1-like element IS1N family transposase -
  C1P63_RS22420 - 4084490..4084694 (+) 205 Protein_4247 hypothetical protein -
  C1P63_RS22430 tyrB 4085983..4087176 (-) 1194 WP_000486959.1 aromatic amino acid transaminase -
  C1P63_RS22435 alr 4087419..4088497 (-) 1079 Protein_4250 alanine racemase -
  C1P63_RS22440 dnaB 4088550..4089965 (-) 1416 WP_000918354.1 replicative DNA helicase -
  C1P63_RS22445 - 4090048..4091031 (+) 984 WP_000235509.1 quinone oxidoreductase -
  C1P63_RS22450 pspG 4091197..4091439 (-) 243 WP_000891404.1 envelope stress response protein PspG -
  C1P63_RS22455 dusA 4091573..4092610 (-) 1038 WP_011378970.1 tRNA dihydrouridine(20/20a) synthase DusA -
  C1P63_RS22460 - 4092929..4093415 (-) 487 Protein_4255 IS1 family transposase -
  C1P63_RS22465 - 4093473..4093745 (-) 273 Protein_4256 DUF2713 domain-containing protein -
  C1P63_RS22470 zur 4094064..4094579 (+) 516 WP_000416263.1 zinc uptake transcriptional repressor Zur -
  C1P63_RS22475 - 4094621..4094830 (-) 210 WP_001030593.1 CsbD family protein -
  C1P63_RS22480 dinF 4094946..4096271 (-) 1326 WP_011378972.1 MATE family efflux transporter DinF -
  C1P63_RS22485 lexA 4096344..4096952 (-) 609 WP_000646078.1 transcriptional repressor LexA -
  C1P63_RS22490 dgkA 4097062..4097430 (-) 369 WP_000002907.1 diacylglycerol kinase -
  C1P63_RS22495 plsB 4097601..4100024 (+) 2424 WP_000017354.1 glycerol-3-phosphate 1-O-acyltransferase PlsB -
  C1P63_RS22500 ubiA 4100179..4101051 (-) 873 WP_000455227.1 4-hydroxybenzoate octaprenyltransferase -
  C1P63_RS22505 ubiC 4101064..4101561 (-) 498 WP_001297295.1 chorismate lyase -
  C1P63_RS22510 - 4101784..4102050 (-) 267 Protein_4265 hypothetical protein -
  C1P63_RS22515 - 4102108..4102804 (+) 697 Protein_4266 IS1 family transposase -
  C1P63_RS22520 - 4102820..4103446 (+) 627 Protein_4267 HlyD family secretion protein -
  C1P63_RS22525 - 4103470..4104030 (-) 561 Protein_4268 LysR substrate-binding domain-containing protein -
  C1P63_RS22530 - 4104089..4104783 (+) 695 WP_134801564.1 IS1-like element IS1N family transposase -
  C1P63_RS22535 - 4105083..4105958 (+) 876 WP_000470158.1 LysR family transcriptional regulator -
  C1P63_RS22540 yhjD 4106007..4107020 (+) 1014 WP_134806296.1 inner membrane protein YhjD -
  C1P63_RS22545 - 4107412..4108734 (+) 1323 WP_001148989.1 MFS transporter -

Sequence


Protein


Download         Length: 178 a.a.        Molecular weight: 18991.04 Da        Isoelectric Point: 5.2358

>NTDB_id=272467 C1P63_RS22375 WP_000168299.1 4077282..4077818(-) (ssb) [Shigella dysenteriae strain 53-3937]
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYI
EGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQLQGGWGQPQQPQGGNQFSGGAQSRPQQSA
PAAPSNEPPMDFDDDIPF

Nucleotide


Download         Length: 537 bp        

>NTDB_id=272467 C1P63_RS22375 WP_000168299.1 4077282..4077818(-) (ssb) [Shigella dysenteriae strain 53-3937]
ATGGCCAGCAGAGGCGTAAACAAGGTTATTCTCGTTGGTAATCTGGGTCAGGACCCGGAAGTACGCTACATGCCAAATGG
TGGCGCAGTTGCCAACATTACGCTGGCTACTTCCGAATCCTGGCGTGATAAAGCGACCGGCGAGATGAAAGAGCAGACTG
AATGGCACCGCGTTGTGCTGTTCGGCAAACTGGCAGAAGTGGCCAGCGAATATCTGCGTAAAGGTTCTCAGGTTTATATC
GAAGGTCAGCTGCGTACCCGTAAATGGACCGATCAATCCGGTCAGGATCGCTACACCACAGAAGTTGTGGTGAACGTTGG
CGGCACTATGCAGATGCTGGGTGGTCGTCAGGGTGGTGGCGCTCCTGCAGGTGGCAATATCGGTGGTGGTCAGCTGCAGG
GCGGTTGGGGTCAGCCTCAGCAGCCGCAGGGTGGCAATCAGTTCAGCGGCGGCGCGCAGTCTCGCCCGCAGCAGTCCGCT
CCGGCAGCGCCGTCTAACGAGCCGCCGATGGACTTTGATGATGACATTCCGTTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q327X2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

74.444

100

0.753

  ssb Glaesserella parasuis strain SC1401

57.923

100

0.596

  ssb Neisseria meningitidis MC58

48.066

100

0.489

  ssb Neisseria gonorrhoeae MS11

48.066

100

0.489


Multiple sequence alignment