Detailed information
Overview
| Name | comW | Type | Regulator |
| Locus tag | C4N11_RS00115 | Genome accession | NZ_CP026670 |
| Coordinates | 23778..24014 (+) | Length | 78 a.a. |
| NCBI ID | WP_000939545.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain endophthalmitis isolate 335 | ||
| Function | stabilization and activation of ComX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 12360..61831 | 23778..24014 | within | 0 |
| IScluster/Tn | 21834..23461 | 23778..24014 | flank | 317 |
Gene organization within MGE regions
Location: 12360..61831
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C4N11_RS00060 (C4N11_00060) | ftsH | 12360..14318 (+) | 1959 | WP_000744545.1 | ATP-dependent zinc metalloprotease FtsH | - |
| C4N11_RS00065 (C4N11_00065) | - | 14384..15640 (-) | 1257 | WP_000436644.1 | ISL3 family transposase | - |
| C4N11_RS00070 (C4N11_00070) | comX/comX2 | 15863..16342 (+) | 480 | WP_000588897.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| C4N11_RS00105 (C4N11_00105) | - | 21834..22680 (+) | 847 | Protein_15 | IS630 family transposase | - |
| C4N11_RS00110 (C4N11_00110) | - | 22715..23512 (-) | 798 | Protein_16 | transposase | - |
| C4N11_RS00115 (C4N11_00115) | comW | 23778..24014 (+) | 237 | WP_000939545.1 | sigma(X)-activator ComW | Regulator |
| C4N11_RS00120 (C4N11_00120) | - | 24245..25531 (+) | 1287 | WP_000205044.1 | adenylosuccinate synthase | - |
| C4N11_RS00125 (C4N11_00125) | tadA | 25732..26199 (+) | 468 | WP_000291870.1 | tRNA adenosine(34) deaminase TadA | - |
| C4N11_RS12380 (C4N11_00135) | - | 26408..27106 (-) | 699 | WP_001106362.1 | site-specific integrase | - |
| C4N11_RS12385 (C4N11_00140) | - | 27196..27549 (-) | 354 | WP_001814135.1 | hypothetical protein | - |
| C4N11_RS00145 (C4N11_00145) | - | 27604..28674 (-) | 1071 | WP_000401841.1 | type I restriction endonuclease | - |
| C4N11_RS00150 (C4N11_00150) | - | 28691..29071 (-) | 381 | WP_000170931.1 | ImmA/IrrE family metallo-endopeptidase | - |
| C4N11_RS00155 (C4N11_00155) | - | 29084..29347 (-) | 264 | WP_000285962.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| C4N11_RS00160 (C4N11_00160) | - | 29347..29580 (-) | 234 | WP_000156419.1 | hypothetical protein | - |
| C4N11_RS00165 (C4N11_00165) | - | 29580..29948 (-) | 369 | WP_000464160.1 | helix-turn-helix domain-containing protein | - |
| C4N11_RS00170 (C4N11_00170) | - | 30520..30711 (+) | 192 | WP_001112859.1 | DNA-binding protein | - |
| C4N11_RS00175 (C4N11_00175) | - | 30734..30937 (+) | 204 | WP_001247549.1 | hypothetical protein | - |
| C4N11_RS00180 (C4N11_00180) | - | 31092..31259 (-) | 168 | WP_000024181.1 | YjzC family protein | - |
| C4N11_RS00185 (C4N11_00185) | - | 31279..31644 (+) | 366 | Protein_30 | autolysin | - |
| C4N11_RS00190 (C4N11_00190) | - | 31864..32043 (-) | 180 | WP_001209433.1 | hypothetical protein | - |
| C4N11_RS12090 | - | 32185..32334 (-) | 150 | WP_001030863.1 | hypothetical protein | - |
| C4N11_RS00195 (C4N11_00195) | - | 32639..33082 (+) | 444 | WP_000701992.1 | dUTP diphosphatase | - |
| C4N11_RS00200 (C4N11_00200) | - | 33084..33599 (+) | 516 | WP_000691236.1 | histidine phosphatase family protein | - |
| C4N11_RS00205 (C4N11_00205) | radA | 33613..34974 (+) | 1362 | WP_075213698.1 | DNA repair protein RadA | Machinery gene |
| C4N11_RS00210 (C4N11_00210) | - | 35047..35544 (+) | 498 | WP_001809263.1 | carbonic anhydrase | - |
| C4N11_RS00215 (C4N11_00215) | - | 35569..36352 (+) | 784 | Protein_37 | PrsW family glutamic-type intramembrane protease | - |
| C4N11_RS00220 (C4N11_00220) | - | 36497..37465 (+) | 969 | WP_000010163.1 | ribose-phosphate diphosphokinase | - |
| C4N11_RS12320 | - | 37583..38510 (+) | 928 | Protein_39 | Rpn family recombination-promoting nuclease/putative transposase | - |
| C4N11_RS00235 (C4N11_00235) | polA | 39119..41752 (+) | 2634 | WP_001812055.1 | DNA polymerase I | - |
| C4N11_RS00240 (C4N11_00240) | - | 41837..42274 (+) | 438 | WP_000076479.1 | CoA-binding protein | - |
| C4N11_RS12390 (C4N11_00245) | - | 42315..42530 (+) | 216 | WP_001814139.1 | hypothetical protein | - |
| C4N11_RS00250 (C4N11_00250) | - | 42549..43559 (-) | 1011 | WP_000009180.1 | YeiH family protein | - |
| C4N11_RS00255 (C4N11_00255) | - | 43708..44877 (+) | 1170 | WP_000366348.1 | pyridoxal phosphate-dependent aminotransferase | - |
| C4N11_RS00260 (C4N11_00260) | recO | 44874..45644 (+) | 771 | WP_000616164.1 | DNA repair protein RecO | - |
| C4N11_RS00265 (C4N11_00265) | plsX | 45641..46633 (+) | 993 | WP_000717451.1 | phosphate acyltransferase PlsX | - |
| C4N11_RS00270 (C4N11_00270) | - | 46639..46872 (+) | 234 | WP_000136449.1 | acyl carrier protein | - |
| C4N11_RS00275 (C4N11_00275) | - | 46918..47209 (+) | 292 | Protein_48 | IS5/IS1182 family transposase | - |
| C4N11_RS00280 (C4N11_00280) | blpU | 47411..47641 (+) | 231 | WP_001093075.1 | bacteriocin-like peptide BlpU | - |
| C4N11_RS12745 | - | 47644..47769 (+) | 126 | WP_000346297.1 | PncF family bacteriocin immunity protein | - |
| C4N11_RS00285 (C4N11_00285) | comA | 48356..50509 (+) | 2154 | WP_000668272.1 | peptide cleavage/export ABC transporter ComA | Regulator |
| C4N11_RS00290 (C4N11_00290) | comB | 50522..51871 (+) | 1350 | WP_000801611.1 | competence pheromone export protein ComB | Regulator |
| C4N11_RS00295 (C4N11_00295) | purC | 52041..52748 (+) | 708 | WP_000043310.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| C4N11_RS00300 (C4N11_00300) | - | 52805..56530 (+) | 3726 | WP_000361217.1 | phosphoribosylformylglycinamidine synthase | - |
| C4N11_RS00305 (C4N11_00305) | purF | 56623..58065 (+) | 1443 | WP_000220632.1 | amidophosphoribosyltransferase | - |
| C4N11_RS00310 (C4N11_00310) | purM | 58102..59124 (+) | 1023 | WP_000182575.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| C4N11_RS00315 (C4N11_00315) | purN | 59121..59666 (+) | 546 | WP_000717506.1 | phosphoribosylglycinamide formyltransferase | - |
| C4N11_RS00320 (C4N11_00320) | - | 59750..60259 (+) | 510 | WP_000894018.1 | VanZ family protein | - |
| C4N11_RS00325 (C4N11_00325) | purH | 60284..61831 (+) | 1548 | WP_000167083.1 | bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase | - |
Sequence
Protein
Download Length: 78 a.a. Molecular weight: 9658.13 Da Isoelectric Point: 6.7051
>NTDB_id=271407 C4N11_RS00115 WP_000939545.1 23778..24014(+) (comW) [Streptococcus pneumoniae strain endophthalmitis isolate 335]
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRKDFIVYHYRVAYRLYLEKLVMNRGFISC
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRKDFIVYHYRVAYRLYLEKLVMNRGFISC
Nucleotide
Download Length: 237 bp
>NTDB_id=271407 C4N11_RS00115 WP_000939545.1 23778..24014(+) (comW) [Streptococcus pneumoniae strain endophthalmitis isolate 335]
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAAGGATTTTA
TTGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGGTTTATTTCTTGTTGA
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAAGGATTTTA
TTGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGGTTTATTTCTTGTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comW | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comW | Streptococcus mitis SK321 |
75.641 |
100 |
0.756 |
| comW | Streptococcus mitis NCTC 12261 |
75.325 |
98.718 |
0.744 |