Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   PH4a_RS02995 Genome accession   NZ_CP026364
Coordinates   617134..617607 (+) Length   157 a.a.
NCBI ID   WP_129037647.1    Uniprot ID   -
Organism   Proteus hauseri strain 15H5D-4a     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 576239..622772 617134..617607 within 0


Gene organization within MGE regions


Location: 576239..622772
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PH4a_RS02680 (PH4a_02695) - 576470..576700 (+) 231 WP_129037569.1 DNA polymerase III subunit theta -
  PH4a_RS02685 (PH4a_02700) - 576701..577321 (-) 621 WP_129037571.1 tail fiber assembly protein -
  PH4a_RS02690 (PH4a_02705) - 577321..578937 (-) 1617 WP_129037573.1 phage tail protein -
  PH4a_RS02695 (PH4a_02710) - 578945..579577 (-) 633 WP_129037575.1 DUF2612 domain-containing protein -
  PH4a_RS02700 (PH4a_02715) - 579577..580767 (-) 1191 WP_129037577.1 baseplate J/gp47 family protein -
  PH4a_RS02705 (PH4a_02720) - 580764..581117 (-) 354 WP_049206563.1 hypothetical protein -
  PH4a_RS02710 (PH4a_02725) - 581119..581811 (-) 693 WP_129037579.1 phage baseplate protein -
  PH4a_RS02715 (PH4a_02730) - 581792..582682 (-) 891 WP_129037581.1 hypothetical protein -
  PH4a_RS02720 (PH4a_02735) - 582669..582944 (-) 276 WP_129037583.1 hypothetical protein -
  PH4a_RS02725 (PH4a_02740) - 582945..583637 (-) 693 WP_129037585.1 phage baseplate protein -
  PH4a_RS02730 (PH4a_02745) - 583734..584216 (-) 483 WP_129041773.1 type II toxin-antitoxin system death-on-curing family toxin -
  PH4a_RS18215 (PH4a_02750) - 584226..584405 (-) 180 WP_129037587.1 hypothetical protein -
  PH4a_RS02740 (PH4a_02755) - 584773..585315 (-) 543 WP_129037589.1 hypothetical protein -
  PH4a_RS02745 (PH4a_02760) - 585354..585818 (-) 465 WP_129037591.1 hypothetical protein -
  PH4a_RS02750 (PH4a_02765) - 585896..586324 (-) 429 WP_129037593.1 hypothetical protein -
  PH4a_RS02755 (PH4a_02770) - 586387..588783 (-) 2397 WP_129037595.1 hypothetical protein -
  PH4a_RS02760 (PH4a_02775) - 589037..589447 (-) 411 WP_129037597.1 hypothetical protein -
  PH4a_RS02765 (PH4a_02780) - 589447..589893 (-) 447 WP_129037599.1 hypothetical protein -
  PH4a_RS02770 (PH4a_02785) - 589906..591363 (-) 1458 WP_129037601.1 DUF3383 domain-containing protein -
  PH4a_RS02775 (PH4a_02790) - 591375..591860 (-) 486 WP_129037603.1 hypothetical protein -
  PH4a_RS02780 (PH4a_02795) - 591848..592228 (-) 381 WP_208730476.1 hypothetical protein -
  PH4a_RS02785 (PH4a_02800) - 592215..592673 (-) 459 WP_129037605.1 hypothetical protein -
  PH4a_RS02790 (PH4a_02805) - 592666..593070 (-) 405 WP_129037607.1 DUF4054 domain-containing protein -
  PH4a_RS18170 - 593073..593399 (-) 327 WP_208730477.1 hypothetical protein -
  PH4a_RS02800 (PH4a_02815) - 593401..594426 (-) 1026 WP_129037609.1 hypothetical protein -
  PH4a_RS02805 (PH4a_02820) - 594426..594914 (-) 489 WP_129037612.1 hypothetical protein -
  PH4a_RS02810 (PH4a_02825) - 594917..596077 (-) 1161 WP_129037614.1 DUF2213 domain-containing protein -
  PH4a_RS02815 (PH4a_02830) - 596127..596933 (-) 807 WP_244212925.1 phage minor head protein -
  PH4a_RS02820 (PH4a_02835) - 596899..598317 (-) 1419 WP_129037616.1 DUF1073 domain-containing protein -
  PH4a_RS02825 (PH4a_02840) - 598314..599657 (-) 1344 WP_129037618.1 PBSX family phage terminase large subunit -
  PH4a_RS02830 (PH4a_02845) - 599650..600174 (-) 525 WP_129037620.1 terminase small subunit -
  PH4a_RS02835 (PH4a_02850) - 600353..600883 (-) 531 WP_129037081.1 Rha family transcriptional regulator -
  PH4a_RS02840 (PH4a_02855) - 601324..601539 (+) 216 WP_129037083.1 KTSC domain-containing protein -
  PH4a_RS02845 (PH4a_02860) - 601569..601937 (-) 369 WP_129037085.1 hypothetical protein -
  PH4a_RS02850 (PH4a_02865) - 601934..602383 (-) 450 WP_129037087.1 lysis protein -
  PH4a_RS02855 (PH4a_02870) - 602380..602772 (-) 393 WP_064720840.1 M15 family metallopeptidase -
  PH4a_RS02860 (PH4a_02875) - 602769..603074 (-) 306 WP_064720841.1 phage holin family protein -
  PH4a_RS02865 (PH4a_02880) - 603500..604003 (-) 504 WP_129037089.1 antiterminator Q family protein -
  PH4a_RS02875 (PH4a_02890) - 604205..604570 (-) 366 WP_129037091.1 RusA family crossover junction endodeoxyribonuclease -
  PH4a_RS02880 (PH4a_02895) - 604567..604857 (-) 291 WP_129037093.1 DUF1364 domain-containing protein -
  PH4a_RS02885 (PH4a_02900) - 604969..605631 (-) 663 WP_129037622.1 metallophosphoesterase -
  PH4a_RS02890 (PH4a_02905) - 605628..606071 (-) 444 WP_129037624.1 YbcN family protein -
  PH4a_RS02895 (PH4a_02910) - 606081..606350 (-) 270 WP_064497299.1 DUF4752 family protein -
  PH4a_RS02900 (PH4a_02915) - 606343..606537 (-) 195 WP_129037101.1 Lar family restriction alleviation protein -
  PH4a_RS02905 (PH4a_02920) - 606539..606817 (-) 279 WP_129037103.1 hypothetical protein -
  PH4a_RS02915 (PH4a_02930) - 607040..607261 (-) 222 WP_129037107.1 MarR family transcriptional regulator -
  PH4a_RS02920 (PH4a_02940) - 607531..607734 (-) 204 WP_123822269.1 hypothetical protein -
  PH4a_RS02925 (PH4a_02945) - 607754..609121 (-) 1368 WP_129041781.1 replicative DNA helicase -
  PH4a_RS02930 (PH4a_02950) - 609125..609961 (-) 837 WP_129037626.1 replication protein -
  PH4a_RS02935 (PH4a_02955) - 610217..610564 (-) 348 WP_110229455.1 hypothetical protein -
  PH4a_RS02940 (PH4a_02960) - 610698..610925 (-) 228 WP_036907955.1 helix-turn-helix domain-containing protein -
  PH4a_RS02945 (PH4a_02965) - 611025..611756 (+) 732 WP_244212926.1 helix-turn-helix transcriptional regulator -
  PH4a_RS02950 (PH4a_02970) - 611936..612346 (+) 411 WP_129037628.1 hypothetical protein -
  PH4a_RS02955 (PH4a_02975) - 612828..613103 (+) 276 WP_129037630.1 hypothetical protein -
  PH4a_RS02960 (PH4a_02980) - 613106..613372 (+) 267 WP_129037632.1 hypothetical protein -
  PH4a_RS02965 (PH4a_02985) - 613430..614020 (+) 591 WP_129037634.1 DUF5420 family protein -
  PH4a_RS02970 (PH4a_02990) - 614112..614549 (+) 438 WP_129037636.1 hypothetical protein -
  PH4a_RS02975 (PH4a_02995) - 614615..615523 (+) 909 WP_129037638.1 cell envelope biogenesis protein TolA -
  PH4a_RS18415 - 615664..615798 (+) 135 WP_255310961.1 hypothetical protein -
  PH4a_RS02980 (PH4a_03000) - 615789..616046 (+) 258 WP_129037640.1 hypothetical protein -
  PH4a_RS18115 - 616043..616195 (+) 153 WP_164971520.1 hypothetical protein -
  PH4a_RS02985 (PH4a_03005) - 616192..616518 (+) 327 WP_129037643.1 hypothetical protein -
  PH4a_RS02990 (PH4a_03010) - 616520..617134 (+) 615 WP_129037645.1 ERF family protein -
  PH4a_RS02995 (PH4a_03015) ssb 617134..617607 (+) 474 WP_129037647.1 single-stranded DNA-binding protein Machinery gene
  PH4a_RS03000 (PH4a_03020) - 617640..617918 (+) 279 WP_129037649.1 hypothetical protein -
  PH4a_RS03005 (PH4a_03025) - 617962..618255 (+) 294 WP_129037651.1 hypothetical protein -
  PH4a_RS03010 (PH4a_03030) - 618327..618563 (-) 237 WP_129037653.1 hypothetical protein -
  PH4a_RS03015 (PH4a_03035) - 618688..619185 (+) 498 WP_129037655.1 ASCH domain-containing protein -
  PH4a_RS03020 (PH4a_03040) - 619255..619935 (+) 681 WP_129037657.1 hypothetical protein -
  PH4a_RS18120 - 620141..620317 (+) 177 WP_164971521.1 hypothetical protein -
  PH4a_RS03025 (PH4a_03045) - 620321..620698 (+) 378 WP_129037659.1 hypothetical protein -
  PH4a_RS03030 (PH4a_03050) - 620676..620858 (+) 183 WP_129037661.1 hypothetical protein -
  PH4a_RS03035 (PH4a_03055) - 620914..621120 (+) 207 WP_103004601.1 DUF4060 family protein -
  PH4a_RS03040 (PH4a_03065) - 621549..622706 (+) 1158 WP_129037663.1 site-specific integrase -

Sequence

Protein


Download         Length: 157 a.a.        Molecular weight: 17248.25 Da        Isoelectric Point: 6.4708

>NTDB_id=268917 PH4a_RS02995 WP_129037647.1 617134..617607(+) (ssb) [Proteus hauseri strain 15H5D-4a]
MASKGVNKVILIGNLGQDPEIRYMPSGGAVANLTLATSESWRDKQTGEMKEKTEWHRVCIFGKLAEIAGEYLKKGSQVYI
EGSLQTRKWQDQGGQDRHTTEVVVNIGGTMQMLGGNGGNQAGSQNPQSQGWGQPQQPQKPAPQNEPPQDWDDQKIPF

Nucleotide


Download         Length: 474 bp        

>NTDB_id=268917 PH4a_RS02995 WP_129037647.1 617134..617607(+) (ssb) [Proteus hauseri strain 15H5D-4a]
ATGGCAAGTAAAGGCGTAAACAAAGTTATTCTTATCGGTAATTTAGGGCAGGATCCAGAAATCCGTTATATGCCTAGTGG
TGGTGCAGTAGCAAACCTGACACTAGCCACATCGGAATCGTGGCGCGACAAACAAACTGGTGAGATGAAGGAAAAAACAG
AGTGGCATCGAGTATGCATCTTCGGCAAATTAGCAGAAATTGCAGGTGAATATCTGAAAAAAGGAAGTCAGGTATATATC
GAAGGTTCTCTACAAACCAGAAAATGGCAAGACCAAGGCGGGCAAGACCGACACACAACGGAAGTAGTAGTCAATATTGG
TGGAACAATGCAGATGCTAGGCGGTAACGGTGGTAATCAGGCAGGAAGCCAGAATCCACAGTCGCAAGGATGGGGTCAAC
CACAGCAACCGCAGAAGCCAGCACCACAAAATGAACCACCTCAAGATTGGGATGATCAAAAAATACCCTTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-112)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

69.101

100

0.783
  ssb Glaesserella parasuis strain SC1401

52.486

100

0.605
  ssb Neisseria meningitidis MC58

51.049

91.083

0.465
  ssb Neisseria gonorrhoeae MS11

51.049

91.083

0.465

Multiple sequence alignment