Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | MC73_RS01890 | Genome accession | NZ_CP026062 |
| Coordinates | 393657..394157 (-) | Length | 166 a.a. |
| NCBI ID | WP_036904885.1 | Uniprot ID | - |
| Organism | Proteus mirabilis strain FDAARGOS_81 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 384943..437928 | 393657..394157 | within | 0 |
Gene organization within MGE regions
Location: 384943..437928
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MC73_RS01835 (MC73_001835) | dnaB | 384943..386352 (-) | 1410 | WP_004245896.1 | replicative DNA helicase | - |
| MC73_RS01840 (MC73_001840) | - | 386520..387503 (+) | 984 | WP_004245895.1 | NADPH:quinone reductase | - |
| MC73_RS01845 (MC73_001845) | dusA | 387610..388644 (-) | 1035 | WP_036904864.1 | tRNA dihydrouridine(20/20a) synthase DusA | - |
| MC73_RS01850 (MC73_001850) | - | 388741..389829 (+) | 1089 | WP_036904867.1 | site-specific integrase | - |
| MC73_RS19215 | - | 389848..389997 (-) | 150 | WP_167392493.1 | hypothetical protein | - |
| MC73_RS01855 (MC73_001855) | - | 390147..390668 (-) | 522 | WP_072021436.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MC73_RS01860 (MC73_001860) | - | 390690..391046 (-) | 357 | WP_036904873.1 | helix-turn-helix transcriptional regulator | - |
| MC73_RS01865 (MC73_001865) | - | 391518..391763 (-) | 246 | WP_036904876.1 | pyocin activator PrtN family protein | - |
| MC73_RS01870 (MC73_001870) | - | 391824..392261 (-) | 438 | WP_080749328.1 | SAM-dependent methyltransferase | - |
| MC73_RS01875 (MC73_001875) | - | 392281..392502 (-) | 222 | WP_036904882.1 | hypothetical protein | - |
| MC73_RS01880 (MC73_001880) | - | 392505..393191 (-) | 687 | WP_036904883.1 | hypothetical protein | - |
| MC73_RS01885 (MC73_001885) | - | 393193..393648 (-) | 456 | WP_052124532.1 | hypothetical protein | - |
| MC73_RS01890 (MC73_001890) | ssb | 393657..394157 (-) | 501 | WP_036904885.1 | single-stranded DNA-binding protein | Machinery gene |
| MC73_RS01895 (MC73_001895) | - | 394216..395043 (-) | 828 | WP_036904887.1 | YfdQ family protein | - |
| MC73_RS01900 (MC73_001900) | - | 395109..395483 (-) | 375 | WP_036904889.1 | hypothetical protein | - |
| MC73_RS01905 (MC73_001905) | - | 395820..396023 (-) | 204 | WP_036904891.1 | hypothetical protein | - |
| MC73_RS01910 (MC73_001910) | - | 396376..396969 (-) | 594 | WP_036905985.1 | helix-turn-helix domain-containing protein | - |
| MC73_RS01915 (MC73_001915) | - | 397079..397291 (+) | 213 | WP_036904893.1 | YdaS family helix-turn-helix protein | - |
| MC73_RS01920 (MC73_001920) | - | 397360..397818 (+) | 459 | WP_036900998.1 | YmfL family putative regulatory protein | - |
| MC73_RS01925 (MC73_001925) | - | 397907..398116 (+) | 210 | WP_036904895.1 | hypothetical protein | - |
| MC73_RS01930 (MC73_001930) | - | 398106..398285 (+) | 180 | WP_036904897.1 | DUF4222 domain-containing protein | - |
| MC73_RS01935 (MC73_001935) | - | 398295..399413 (+) | 1119 | WP_036904900.1 | hypothetical protein | - |
| MC73_RS01940 (MC73_001940) | - | 399413..400894 (+) | 1482 | WP_036904902.1 | phage N-6-adenine-methyltransferase | - |
| MC73_RS01945 (MC73_001945) | - | 400867..401283 (+) | 417 | WP_223304298.1 | hypothetical protein | - |
| MC73_RS19680 (MC73_001950) | - | 401340..401453 (+) | 114 | WP_397389537.1 | hypothetical protein | - |
| MC73_RS01955 (MC73_001955) | - | 401516..401899 (+) | 384 | WP_036904907.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MC73_RS01960 (MC73_001960) | - | 401918..402721 (+) | 804 | WP_036904909.1 | KilA-N domain-containing protein | - |
| MC73_RS01965 (MC73_001965) | - | 402718..403743 (+) | 1026 | WP_036904911.1 | DUF968 domain-containing protein | - |
| MC73_RS01970 (MC73_001970) | - | 403771..404556 (+) | 786 | WP_036904913.1 | antitermination protein | - |
| MC73_RS01975 (MC73_001975) | - | 404605..404949 (+) | 345 | WP_036904915.1 | hypothetical protein | - |
| MC73_RS01980 (MC73_001980) | - | 405145..405339 (+) | 195 | WP_036904917.1 | hypothetical protein | - |
| MC73_RS01985 (MC73_001985) | - | 405412..406434 (+) | 1023 | WP_036904919.1 | site-specific DNA-methyltransferase | - |
| MC73_RS01990 (MC73_001990) | - | 406498..407295 (-) | 798 | WP_036904921.1 | hypothetical protein | - |
| MC73_RS01995 (MC73_001995) | - | 407473..407796 (+) | 324 | WP_036904922.1 | GrlR family regulatory protein | - |
| MC73_RS02005 (MC73_002005) | - | 408156..408425 (+) | 270 | WP_036904926.1 | bacteriophage protein | - |
| MC73_RS02010 (MC73_002010) | - | 408425..408895 (+) | 471 | WP_036904929.1 | lysozyme | - |
| MC73_RS19220 | - | 408877..409035 (+) | 159 | WP_190306334.1 | hypothetical protein | - |
| MC73_RS02015 (MC73_002015) | - | 409038..409520 (+) | 483 | WP_036904932.1 | lysis protein | - |
| MC73_RS19685 (MC73_002020) | - | 409760..409963 (-) | 204 | WP_036904935.1 | KTSC domain-containing protein | - |
| MC73_RS02030 (MC73_002030) | - | 410904..411251 (+) | 348 | WP_036904942.1 | HNH endonuclease | - |
| MC73_RS02035 (MC73_002035) | - | 411414..411887 (+) | 474 | WP_036904945.1 | phage terminase small subunit P27 family | - |
| MC73_RS02040 (MC73_002040) | - | 411891..413624 (+) | 1734 | WP_036904948.1 | terminase large subunit | - |
| MC73_RS02050 (MC73_002050) | - | 413813..415042 (+) | 1230 | WP_023582514.1 | phage portal protein | - |
| MC73_RS02055 (MC73_002055) | - | 415020..415664 (+) | 645 | WP_170832166.1 | HK97 family phage prohead protease | - |
| MC73_RS02060 (MC73_002060) | - | 415678..416886 (+) | 1209 | WP_036904960.1 | phage major capsid protein | - |
| MC73_RS02065 (MC73_002065) | - | 416980..417285 (+) | 306 | WP_036901048.1 | head-tail connector protein | - |
| MC73_RS02070 (MC73_002070) | - | 417285..417611 (+) | 327 | WP_036904963.1 | phage head closure protein | - |
| MC73_RS02075 (MC73_002075) | - | 417598..417987 (+) | 390 | WP_036904966.1 | hypothetical protein | - |
| MC73_RS02080 (MC73_002080) | - | 417987..418388 (+) | 402 | WP_190306338.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MC73_RS02085 (MC73_002085) | - | 418400..418873 (+) | 474 | WP_006533916.1 | hypothetical protein | - |
| MC73_RS02090 (MC73_002090) | - | 418873..419223 (+) | 351 | WP_036904969.1 | phage tail protein | - |
| MC73_RS02100 (MC73_002100) | - | 419482..422790 (+) | 3309 | WP_036904971.1 | phage tail tape measure protein | - |
| MC73_RS02105 (MC73_002105) | - | 422791..423390 (+) | 600 | WP_036904973.1 | hypothetical protein | - |
| MC73_RS02110 (MC73_002110) | - | 423387..423968 (+) | 582 | WP_036904975.1 | hypothetical protein | - |
| MC73_RS02115 (MC73_002115) | - | 423992..424600 (+) | 609 | WP_036904977.1 | hypothetical protein | - |
| MC73_RS02120 (MC73_002120) | - | 424657..425055 (+) | 399 | WP_036904980.1 | DUF6950 family protein | - |
| MC73_RS02125 (MC73_002125) | - | 425056..427977 (+) | 2922 | WP_036904984.1 | DUF1983 domain-containing protein | - |
| MC73_RS02130 (MC73_002130) | - | 427980..428711 (+) | 732 | WP_036904987.1 | hypothetical protein | - |
| MC73_RS02140 (MC73_002140) | - | 429063..430442 (+) | 1380 | WP_052124534.1 | hypothetical protein | - |
| MC73_RS02145 (MC73_002145) | - | 430518..431114 (-) | 597 | WP_036904992.1 | hypothetical protein | - |
| MC73_RS19625 (MC73_002150) | - | 431396..431521 (-) | 126 | WP_263281906.1 | hypothetical protein | - |
| MC73_RS02155 (MC73_002155) | - | 431865..433139 (+) | 1275 | WP_004249170.1 | S8 family peptidase | - |
| MC73_RS02160 (MC73_002160) | potA | 433583..434698 (+) | 1116 | WP_004245891.1 | spermidine/putrescine ABC transporter ATP-binding protein PotA | - |
| MC73_RS02165 (MC73_002165) | potB | 434682..435542 (+) | 861 | WP_004250112.1 | spermidine/putrescine ABC transporter permease PotB | - |
| MC73_RS02170 (MC73_002170) | potC | 435539..436318 (+) | 780 | WP_004245888.1 | spermidine/putrescine ABC transporter permease PotC | - |
| MC73_RS02175 (MC73_002175) | potD | 436435..437478 (+) | 1044 | WP_004245887.1 | spermidine/putrescine ABC transporter substrate-binding protein PotD | - |
| MC73_RS02180 (MC73_002180) | - | 437611..437928 (-) | 318 | WP_004245886.1 | helix-turn-helix domain-containing protein | - |
Sequence
Protein
Download Length: 166 a.a. Molecular weight: 18115.59 Da Isoelectric Point: 8.0054
>NTDB_id=266229 MC73_RS01890 WP_036904885.1 393657..394157(-) (ssb) [Proteus mirabilis strain FDAARGOS_81]
MANGSVNKVILIGNLGRDPEIRYLPSGGAVANLAVATSENWRDKKTGESREKTEWHRVVIFGKLAEIAGGYLCKGSQIYI
EGQLQTKEWDDNGIKRYTTEIIVNVGGKMQMLGGASKSAGSQPAQQNKPPAQPQAQGNQQPPIDFEDDIPFAPIGLMYPR
HLINVI
MANGSVNKVILIGNLGRDPEIRYLPSGGAVANLAVATSENWRDKKTGESREKTEWHRVVIFGKLAEIAGGYLCKGSQIYI
EGQLQTKEWDDNGIKRYTTEIIVNVGGKMQMLGGASKSAGSQPAQQNKPPAQPQAQGNQQPPIDFEDDIPFAPIGLMYPR
HLINVI
Nucleotide
Download Length: 501 bp
>NTDB_id=266229 MC73_RS01890 WP_036904885.1 393657..394157(-) (ssb) [Proteus mirabilis strain FDAARGOS_81]
ATGGCTAACGGATCAGTAAACAAAGTAATTCTTATCGGCAATTTAGGGCGCGATCCTGAAATTCGCTATCTTCCGAGTGG
TGGTGCTGTTGCTAATTTAGCTGTGGCCACAAGTGAAAATTGGCGTGATAAAAAAACAGGTGAAAGCCGTGAAAAAACAG
AATGGCATCGTGTAGTAATTTTCGGCAAGTTAGCAGAAATTGCAGGCGGTTACCTGTGTAAAGGCTCACAAATTTATATC
GAAGGTCAGTTACAGACTAAAGAGTGGGATGATAACGGAATTAAGCGTTATACAACTGAAATCATCGTCAATGTTGGCGG
AAAAATGCAAATGTTAGGTGGTGCTAGTAAATCAGCAGGATCACAACCAGCACAGCAAAACAAACCACCAGCTCAACCTC
AAGCCCAAGGAAACCAGCAACCCCCAATTGATTTTGAAGATGACATCCCTTTCGCCCCGATTGGACTTATGTATCCACGC
CATTTAATTAATGTGATTTAG
ATGGCTAACGGATCAGTAAACAAAGTAATTCTTATCGGCAATTTAGGGCGCGATCCTGAAATTCGCTATCTTCCGAGTGG
TGGTGCTGTTGCTAATTTAGCTGTGGCCACAAGTGAAAATTGGCGTGATAAAAAAACAGGTGAAAGCCGTGAAAAAACAG
AATGGCATCGTGTAGTAATTTTCGGCAAGTTAGCAGAAATTGCAGGCGGTTACCTGTGTAAAGGCTCACAAATTTATATC
GAAGGTCAGTTACAGACTAAAGAGTGGGATGATAACGGAATTAAGCGTTATACAACTGAAATCATCGTCAATGTTGGCGG
AAAAATGCAAATGTTAGGTGGTGCTAGTAAATCAGCAGGATCACAACCAGCACAGCAAAACAAACCACCAGCTCAACCTC
AAGCCCAAGGAAACCAGCAACCCCCAATTGATTTTGAAGATGACATCCCTTTCGCCCCGATTGGACTTATGTATCCACGC
CATTTAATTAATGTGATTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
55.932 |
100 |
0.596 |
| ssb | Glaesserella parasuis strain SC1401 |
47.802 |
100 |
0.524 |
| ssb | Neisseria meningitidis MC58 |
45.402 |
100 |
0.476 |
| ssb | Neisseria gonorrhoeae MS11 |
45.402 |
100 |
0.476 |