Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   BS11774_RS18610 Genome accession   NZ_CP026010
Coordinates   3491274..3491657 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis strain ATCC 11774     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3486274..3496657
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BS11774_RS18570 (BS11774_18460) sinI 3487206..3487379 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BS11774_RS18575 (BS11774_18465) sinR 3487413..3487769 (+) 357 WP_128474275.1 transcriptional regulator SinR Regulator
  BS11774_RS18580 (BS11774_18470) tasA 3487842..3488627 (-) 786 WP_128474056.1 biofilm matrix protein TasA -
  BS11774_RS18585 (BS11774_18475) sipW 3488691..3489263 (-) 573 WP_072692741.1 signal peptidase I SipW -
  BS11774_RS18590 (BS11774_18480) tapA 3489247..3490008 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  BS11774_RS18595 (BS11774_18485) yqzG 3490280..3490606 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BS11774_RS18600 (BS11774_18490) spoIITA 3490648..3490827 (-) 180 WP_029726723.1 YqzE family protein -
  BS11774_RS18605 (BS11774_18495) comGG 3490899..3491273 (-) 375 WP_029317914.1 ComG operon protein ComGG Machinery gene
  BS11774_RS18610 (BS11774_18500) comGF 3491274..3491657 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  BS11774_RS18615 (BS11774_18505) comGE 3491683..3492030 (-) 348 WP_088272394.1 ComG operon protein 5 Machinery gene
  BS11774_RS18620 (BS11774_18510) comGD 3492014..3492445 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  BS11774_RS18625 (BS11774_18515) comGC 3492435..3492731 (-) 297 WP_128474057.1 comG operon protein ComGC Machinery gene
  BS11774_RS18630 (BS11774_18520) comGB 3492745..3493782 (-) 1038 WP_128474058.1 comG operon protein ComGB Machinery gene
  BS11774_RS18635 (BS11774_18525) comGA 3493769..3494839 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  BS11774_RS18640 (BS11774_18530) - 3495052..3495249 (-) 198 WP_029726717.1 hypothetical protein -
  BS11774_RS18645 (BS11774_18535) corA 3495251..3496204 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=265005 BS11774_RS18610 WP_029726721.1 3491274..3491657(-) (comGF) [Bacillus subtilis strain ATCC 11774]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=265005 BS11774_RS18610 WP_029726721.1 3491274..3491657(-) (comGF) [Bacillus subtilis strain ATCC 11774]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969


Multiple sequence alignment