Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BS11774_RS18570 Genome accession   NZ_CP026010
Coordinates   3487206..3487379 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain ATCC 11774     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 3482206..3492379
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BS11774_RS18555 (BS11774_18445) gcvT 3483006..3484094 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  BS11774_RS18560 (BS11774_18450) hepAA 3484535..3486208 (+) 1674 WP_128474055.1 SNF2-related protein -
  BS11774_RS18565 (BS11774_18455) yqhG 3486229..3487023 (+) 795 WP_015714249.1 YqhG family protein -
  BS11774_RS18570 (BS11774_18460) sinI 3487206..3487379 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BS11774_RS18575 (BS11774_18465) sinR 3487413..3487769 (+) 357 WP_128474275.1 transcriptional regulator SinR Regulator
  BS11774_RS18580 (BS11774_18470) tasA 3487842..3488627 (-) 786 WP_128474056.1 biofilm matrix protein TasA -
  BS11774_RS18585 (BS11774_18475) sipW 3488691..3489263 (-) 573 WP_072692741.1 signal peptidase I SipW -
  BS11774_RS18590 (BS11774_18480) tapA 3489247..3490008 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  BS11774_RS18595 (BS11774_18485) yqzG 3490280..3490606 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BS11774_RS18600 (BS11774_18490) spoIITA 3490648..3490827 (-) 180 WP_029726723.1 YqzE family protein -
  BS11774_RS18605 (BS11774_18495) comGG 3490899..3491273 (-) 375 WP_029317914.1 ComG operon protein ComGG Machinery gene
  BS11774_RS18610 (BS11774_18500) comGF 3491274..3491657 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  BS11774_RS18615 (BS11774_18505) comGE 3491683..3492030 (-) 348 WP_088272394.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=265002 BS11774_RS18570 WP_003230187.1 3487206..3487379(+) (sinI) [Bacillus subtilis strain ATCC 11774]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=265002 BS11774_RS18570 WP_003230187.1 3487206..3487379(+) (sinI) [Bacillus subtilis strain ATCC 11774]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment