Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HAC_RS00230 Genome accession   NC_008229
Coordinates   49038..49175 (+) Length   45 a.a.
NCBI ID   WP_041600153.1    Uniprot ID   -
Organism   Helicobacter acinonychis str. Sheeba     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 44038..54175
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HAC_RS00205 (Hac_0046) - 44082..46301 (+) 2220 WP_011577031.1 AAA family ATPase -
  HAC_RS00210 (Hac_0047) panD 46291..46641 (+) 351 WP_041600152.1 aspartate 1-decarboxylase -
  HAC_RS00215 (Hac_0048) - 46652..46945 (+) 294 WP_011577033.1 YbaB/EbfC family nucleoid-associated protein -
  HAC_RS00220 (Hac_0049) - 46945..47940 (+) 996 WP_011577034.1 PDZ domain-containing protein -
  HAC_RS00225 (Hac_0050) comB6 47948..49012 (+) 1065 WP_011577035.1 P-type conjugative transfer protein TrbL Machinery gene
  HAC_RS00230 comB7 49038..49175 (+) 138 WP_041600153.1 hypothetical protein Machinery gene
  HAC_RS00235 (Hac_0052) comB8 49172..49915 (+) 744 WP_011577036.1 type IV secretion system protein Machinery gene
  HAC_RS00240 (Hac_0053) comB9 49915..50865 (+) 951 WP_011577037.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HAC_RS00245 (Hac_0054) comB10 50858..51994 (+) 1137 WP_011577038.1 DNA type IV secretion system protein ComB10 Machinery gene
  HAC_RS00250 (Hac_0055) - 52059..53471 (+) 1413 WP_041600249.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 45 a.a.        Molecular weight: 5081.20 Da        Isoelectric Point: 8.5434

>NTDB_id=26062 HAC_RS00230 WP_041600153.1 49038..49175(+) (comB7) [Helicobacter acinonychis str. Sheeba]
MKIFLLLVGLVLIGCTSKVHEMKKSPCALHEKMHEKLYENGLNLA

Nucleotide


Download         Length: 138 bp        

>NTDB_id=26062 HAC_RS00230 WP_041600153.1 49038..49175(+) (comB7) [Helicobacter acinonychis str. Sheeba]
ATGAAAATTTTTTTATTATTGGTGGGGTTGGTGCTTATTGGTTGCACAAGCAAGGTGCATGAGATGAAAAAAAGCCCTTG
TGCATTGCATGAAAAGATGCATGAAAAACTATATGAAAACGGATTAAACCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

62.222

100

0.622


Multiple sequence alignment