Detailed information NTG0256293

Bioinformatically predicted

Overview

• Name: ssb
• Type: Machinery gene
• Locus tag: BG454_RS10835
• Genome accession: NZ_CP024899
• Coordinates: 2265709..2266191 (-)
• Length: 160 a.a.
• NCBI ID: WP_071480764.1
• Uniprot ID: A0A2K8K9X5
• Organism: Roseinatronobacter bogoriensis subsp. barguzinensis strain alga05
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	2256738..2268313	2265709..2266191	within	0

Gene organization within MGE regions

Location: 2256738..2268313

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BG454_RS10780 (BG454_10785)	-	2256738..2258051 (+)	1314	WP_071480755.1	site-specific integrase	-
BG454_RS10785 (BG454_10790)	-	2258048..2258617 (+)	570	WP_071480756.1	hypothetical protein	-
BG454_RS19290 (BG454_10795)	-	2258705..2258866 (+)	162	WP_084634892.1	AlpA family transcriptional regulator	-
BG454_RS10795 (BG454_10800)	-	2258863..2259147 (+)	285	WP_071480757.1	hypothetical protein	-
BG454_RS10800 (BG454_10805)	-	2259144..2259374 (+)	231	WP_071480758.1	hypothetical protein	-
BG454_RS10805 (BG454_10810)	-	2259371..2261653 (+)	2283	WP_071480759.1	phage/plasmid primase, P4 family	-
BG454_RS10810 (BG454_10815)	-	2262062..2262409 (+)	348	WP_071480760.1	hypothetical protein	-
BG454_RS18785	-	2262406..2262546 (+)	141	WP_157798933.1	hypothetical protein	-
BG454_RS10815 (BG454_10820)	-	2262543..2263976 (+)	1434	WP_071480761.1	hypothetical protein	-
BG454_RS10820 (BG454_10825)	-	2263988..2265136 (+)	1149	WP_071480762.1	phage major capsid protein	-
BG454_RS10825 (BG454_10830)	-	2265293..2265499 (+)	207	WP_071480763.1	hypothetical protein	-
BG454_RS10835 (BG454_10840)	ssb	2265709..2266191 (-)	483	WP_071480764.1	single-stranded DNA-binding protein	Machinery gene
BG454_RS10840 (BG454_10845)	-	2266368..2267003 (+)	636	WP_071480765.1	lytic transglycosylase domain-containing protein	-
BG454_RS10845 (BG454_10850)	-	2267072..2268313 (+)	1242	WP_071480766.1	aminotransferase class V-fold PLP-dependent enzyme	-

Sequence

Protein

• Length: 160 a.a.
• Molecular weight: 17402.18 Da
• Isoelectric Point: 6.9866

>NTDB_id=256293 BG454_RS10835 WP_071480764.1 2265709..2266191(-) (ssb) [Roseinatronobacter bogoriensis subsp. barguzinensis strain alga05]
MAGSVNKVIIIGNLGRDPEIRSFPSGGKVCNLRIATSERWRDKNTGEQREKTEWHSVAIFNEGLVRIAEQYLRKGSTVYI
EGQLETRKWQDQSGADRYSTEIVLRPYRGELTMLGSRADGGGSSGGGGDYGRGQDRGGNYGSGRGSAPSGPADMDDEIPF

Nucleotide

• Length: 483 bp

>NTDB_id=256293 BG454_RS10835 WP_071480764.1 2265709..2266191(-) (ssb) [Roseinatronobacter bogoriensis subsp. barguzinensis strain alga05]
ATGGCAGGATCTGTCAACAAGGTCATCATCATTGGAAATTTGGGGCGCGACCCCGAGATCCGCAGCTTTCCCAGTGGCGG
CAAGGTCTGCAATCTGCGCATTGCCACATCCGAACGCTGGCGCGACAAGAACACGGGCGAACAGCGCGAAAAGACCGAAT
GGCACAGTGTTGCAATTTTCAACGAAGGGCTGGTGCGGATCGCGGAACAGTATCTGCGCAAAGGCTCGACCGTCTATATC
GAAGGGCAGCTGGAAACCCGCAAATGGCAAGACCAGTCTGGCGCAGACCGGTATTCGACTGAAATCGTTCTGCGTCCTTA
CAGGGGTGAACTGACGATGCTGGGTAGTCGCGCAGATGGCGGTGGCAGCAGCGGCGGCGGTGGCGATTATGGCAGAGGCC
AGGATCGCGGCGGCAATTACGGCTCCGGGCGCGGCTCTGCCCCATCCGGCCCGGCAGATATGGATGACGAAATCCCGTTC
TGA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (5-105)

3D structure

• AlphaFold DB: A0A2K8K9X5

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssb	Vibrio cholerae strain A1552	54.335	100	0.587
ssb	Glaesserella parasuis strain SC1401	54	93.75	0.506
ssb	Neisseria meningitidis MC58	39.106	100	0.437
ssb	Neisseria gonorrhoeae MS11	39.106	100	0.437