Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   CU078_RS05725 Genome accession   NZ_CP024821
Coordinates   1032767..1033270 (+) Length   167 a.a.
NCBI ID   WP_072644843.1    Uniprot ID   -
Organism   Escherichia coli strain CREC-591     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 999214..1042261 1032767..1033270 within 0


Gene organization within MGE regions


Location: 999214..1042261
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CU078_RS05460 (CU078_05460) - 999214..1001253 (-) 2040 WP_077891786.1 phage tailspike protein -
  CU078_RS05465 (CU078_05465) - 1001354..1002256 (-) 903 WP_072644829.1 phage antirepressor N-terminal domain-containing protein -
  CU078_RS05470 (CU078_05470) - 1002319..1002540 (-) 222 WP_072644830.1 hypothetical protein -
  CU078_RS05475 (CU078_05475) - 1002537..1002677 (-) 141 WP_001386205.1 Arc family DNA-binding protein -
  CU078_RS05480 (CU078_05480) - 1002783..1003034 (+) 252 WP_001283827.1 Arc family DNA-binding protein -
  CU078_RS05485 (CU078_05485) - 1003031..1003240 (+) 210 WP_001036007.1 hypothetical protein -
  CU078_RS05490 (CU078_05490) - 1003215..1003493 (-) 279 WP_223195166.1 hemolysin XhlA family protein -
  CU078_RS05495 (CU078_05495) - 1003725..1003904 (+) 180 WP_001085430.1 hypothetical protein -
  CU078_RS05500 (CU078_05500) - 1003918..1004283 (-) 366 WP_072644831.1 hypothetical protein -
  CU078_RS05505 (CU078_05505) - 1004335..1004703 (+) 369 WP_085956046.1 hypothetical protein -
  CU078_RS05510 (CU078_05510) - 1004728..1006638 (-) 1911 WP_000331835.1 hypothetical protein -
  CU078_RS05515 (CU078_05515) - 1006638..1008023 (-) 1386 WP_072644833.1 DNA transfer protein -
  CU078_RS05520 (CU078_05520) - 1008034..1008726 (-) 693 WP_000964872.1 DNA transfer protein -
  CU078_RS05525 (CU078_05525) - 1008729..1009184 (-) 456 WP_072644834.1 DUF2824 family protein -
  CU078_RS05530 (CU078_05530) - 1009184..1010137 (-) 954 WP_001535935.1 tail needle knob protein -
  CU078_RS05535 (CU078_05535) - 1010137..1011555 (-) 1419 WP_072644835.1 packaged DNA stabilization protein gp10 -
  CU078_RS05540 (CU078_05540) - 1011555..1012055 (-) 501 WP_021514122.1 packaged DNA stabilization gp4 family protein -
  CU078_RS05545 (CU078_05545) - 1012033..1012269 (-) 237 WP_021568315.1 hypothetical protein -
  CU078_RS05550 (CU078_05550) - 1012314..1013609 (-) 1296 WP_021568314.1 P22 phage major capsid protein family protein -
  CU078_RS05555 (CU078_05555) - 1013609..1014520 (-) 912 WP_000373006.1 scaffold protein -
  CU078_RS05560 (CU078_05560) - 1014534..1016699 (-) 2166 WP_072644836.1 portal protein -
  CU078_RS05565 (CU078_05565) - 1016700..1018199 (-) 1500 WP_072644837.1 terminase family protein -
  CU078_RS05570 (CU078_05570) - 1018177..1018665 (-) 489 WP_077890887.1 DNA-packaging protein -
  CU078_RS05575 (CU078_05575) - 1018745..1018987 (-) 243 WP_000807788.1 DUF2560 family protein -
  CU078_RS05580 (CU078_05580) - 1019341..1019859 (-) 519 WP_001016386.1 Rha family transcriptional regulator -
  CU078_RS05585 (CU078_05585) - 1020059..1020496 (-) 438 WP_072644839.1 lysis protein -
  CU078_RS05590 (CU078_05590) - 1020493..1020969 (-) 477 WP_021521977.1 glycoside hydrolase family protein -
  CU078_RS05595 (CU078_05595) - 1020953..1021276 (-) 324 WP_000783734.1 phage holin, lambda family -
  CU078_RS05610 (CU078_05610) - 1021739..1022257 (-) 519 WP_072644840.1 antiterminator Q family protein -
  CU078_RS05615 (CU078_05615) - 1022254..1022442 (-) 189 WP_000994516.1 protein ninH -
  CU078_RS05620 (CU078_05620) - 1022439..1022801 (-) 363 WP_001008200.1 RusA family crossover junction endodeoxyribonuclease -
  CU078_RS05625 (CU078_05625) - 1022798..1023088 (-) 291 WP_000002231.1 DUF1364 domain-containing protein -
  CU078_RS05630 (CU078_05630) - 1023088..1023357 (-) 270 WP_001279421.1 hypothetical protein -
  CU078_RS05635 (CU078_05635) - 1023350..1023520 (-) 171 WP_000566866.1 protein NinF -
  CU078_RS05640 (CU078_05640) - 1023517..1023699 (-) 183 WP_001254250.1 NinE family protein -
  CU078_RS05645 (CU078_05645) - 1023696..1024223 (-) 528 WP_000153280.1 phage N-6-adenine-methyltransferase -
  CU078_RS05650 (CU078_05650) - 1024220..1024660 (-) 441 WP_047400585.1 recombination protein NinB -
  CU078_RS05665 (CU078_05665) - 1024939..1026819 (-) 1881 WP_001322819.1 toprim domain-containing protein -
  CU078_RS05670 (CU078_05670) - 1026927..1027787 (-) 861 WP_000067068.1 replication protein -
  CU078_RS05675 (CU078_05675) - 1027780..1027926 (-) 147 WP_000166207.1 DUF2740 family protein -
  CU078_RS05680 (CU078_05680) - 1027959..1028252 (-) 294 WP_000251073.1 lambda phage CII family protein -
  CU078_RS05685 (CU078_05685) - 1028361..1028546 (-) 186 WP_000276886.1 Cro/CI family transcriptional regulator -
  CU078_RS05690 (CU078_05690) - 1028627..1029277 (+) 651 WP_000856967.1 LexA family transcriptional regulator -
  CU078_RS05695 (CU078_05695) - 1029591..1029896 (+) 306 WP_001309622.1 hypothetical protein -
  CU078_RS05700 (CU078_05700) - 1030167..1030367 (+) 201 WP_000213975.1 antirestriction Ral family protein -
  CU078_RS05705 (CU078_05705) - 1030543..1031511 (+) 969 WP_072644841.1 cell envelope biogenesis protein TolA -
  CU078_RS05710 (CU078_05710) - 1031536..1031667 (+) 132 WP_000638547.1 protease FtsH-inhibitory lysogeny factor CIII -
  CU078_RS05715 (CU078_05715) kil 1031652..1031804 (+) 153 WP_001518153.1 host cell division inhibitory peptide Kil -
  CU078_RS05720 (CU078_05720) - 1032059..1032766 (+) 708 WP_072644842.1 Rad52/Rad22 family DNA repair protein -
  CU078_RS05725 (CU078_05725) ssb 1032767..1033270 (+) 504 WP_072644843.1 single-stranded DNA-binding protein Machinery gene
  CU078_RS05730 (CU078_05730) - 1033279..1033827 (+) 549 WP_072644844.1 3'-5' exonuclease -
  CU078_RS05735 (CU078_05735) - 1033844..1034137 (+) 294 WP_072644845.1 phage anti-RecBCD protein -
  CU078_RS05740 (CU078_05740) - 1034148..1034312 (+) 165 WP_001214452.1 DUF2737 family protein -
  CU078_RS05745 (CU078_05745) - 1034309..1034944 (+) 636 WP_077890885.1 hypothetical protein -
  CU078_RS05750 (CU078_05750) - 1034941..1035546 (+) 606 WP_072644846.1 ead/Ea22-like family protein -
  CU078_RS05755 (CU078_05755) - 1035613..1035855 (+) 243 WP_000492058.1 DUF4222 domain-containing protein -
  CU078_RS05765 (CU078_05765) - 1035974..1036141 (+) 168 WP_001518157.1 hypothetical protein -
  CU078_RS05770 (CU078_05770) - 1036181..1036399 (+) 219 WP_001303849.1 excisionase -
  CU078_RS05775 (CU078_05775) - 1036377..1037450 (+) 1074 WP_001609775.1 tyrosine-type recombinase/integrase -
  CU078_RS05780 (CU078_05780) torS 1037545..1040289 (+) 2745 WP_001367057.1 TMAO reductase system sensor histidine kinase/response regulator TorS -
  CU078_RS05785 (CU078_05785) yccM 1040361..1041434 (+) 1074 WP_000829672.1 4Fe-4S binding protein -
  CU078_RS05790 (CU078_05790) gnsA 1041482..1041655 (-) 174 WP_001019197.1 addiction module toxin, GnsA/GnsB family -
  CU078_RS05795 (CU078_05795) ymcE 1041645..1041875 (-) 231 WP_001316982.1 protein YmcE -
  CU078_RS05800 (CU078_05800) ymcF 1041850..1042038 (-) 189 WP_071524630.1 cold-shock protein -
  CU078_RS05805 (CU078_05805) cspG 1042049..1042261 (-) 213 WP_000066490.1 cold shock protein CspG -

Sequence


Protein


Download         Length: 167 a.a.        Molecular weight: 18627.83 Da        Isoelectric Point: 7.4683

>NTDB_id=255653 CU078_RS05725 WP_072644843.1 1032767..1033270(+) (ssb) [Escherichia coli strain CREC-591]
MASRGVNKVIIIGRLGHDPEIRYSPSGTAFANLTVATSEQWRDKQTGEKKEQTEWHRVVMSGKLAEIASEYLRKGSEVYL
EGKLRTRKWQDQSGQDRFTTEIIVGVGGTMQMIGGKQGGNEQSSPQRNNGQQPQQQGNHSEPPMDFDDDIPFAPVTLPFP
RHAIHAI

Nucleotide


Download         Length: 504 bp        

>NTDB_id=255653 CU078_RS05725 WP_072644843.1 1032767..1033270(+) (ssb) [Escherichia coli strain CREC-591]
ATGGCAAGCAGAGGCGTAAATAAGGTGATCATTATTGGTCGCCTTGGGCATGATCCAGAAATCAGATATTCACCATCAGG
AACGGCATTTGCAAACCTTACAGTTGCTACGTCAGAACAGTGGCGTGATAAGCAAACTGGAGAGAAAAAGGAGCAGACGG
AGTGGCACCGTGTGGTAATGAGCGGGAAACTGGCAGAAATTGCCAGCGAATATCTGCGAAAAGGCTCTGAGGTTTATCTT
GAAGGCAAATTGCGGACAAGAAAATGGCAGGATCAAAGCGGACAGGATCGGTTCACTACCGAAATCATCGTGGGCGTTGG
TGGAACTATGCAAATGATTGGTGGCAAGCAAGGAGGCAATGAACAGTCTTCACCTCAGCGAAATAACGGTCAGCAACCTC
AGCAGCAAGGGAATCACAGCGAACCACCTATGGATTTTGACGACGATATCCCCTTTGCACCAGTAACTCTCCCCTTCCCT
CGTCACGCTATTCACGCAATTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

60.452

100

0.641

  ssb Glaesserella parasuis strain SC1401

51.381

100

0.557

  ssb Neisseria gonorrhoeae MS11

41.477

100

0.437

  ssb Neisseria meningitidis MC58

40.341

100

0.425


Multiple sequence alignment