Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | CTZ23_RS00855 | Genome accession | NZ_CP024620 |
| Coordinates | 187126..187692 (+) | Length | 188 a.a. |
| NCBI ID | WP_045795510.1 | Uniprot ID | A0AAW8Z9U3 |
| Organism | Acinetobacter indicus strain SGAir0564 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 177499..243785 | 187126..187692 | within | 0 |
Gene organization within MGE regions
Location: 177499..243785
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CTZ23_RS00820 (CTZ23_00820) | - | 178421..179068 (-) | 648 | Protein_159 | IS256 family transposase | - |
| CTZ23_RS00825 (CTZ23_00825) | uvrA | 179170..182001 (-) | 2832 | WP_104988033.1 | excinuclease ABC subunit UvrA | - |
| CTZ23_RS00830 (CTZ23_00830) | tenA | 182251..182928 (-) | 678 | WP_104988034.1 | thiaminase II | - |
| CTZ23_RS00835 (CTZ23_00835) | - | 183199..184164 (+) | 966 | Protein_162 | DUF475 domain-containing protein | - |
| CTZ23_RS00840 (CTZ23_00840) | - | 184121..185272 (-) | 1152 | WP_005176703.1 | IS4-like element ISAbe18 family transposase | - |
| CTZ23_RS00845 (CTZ23_00845) | - | 185369..185557 (+) | 189 | Protein_164 | DUF475 domain-containing protein | - |
| CTZ23_RS00850 (CTZ23_00850) | - | 185710..187074 (+) | 1365 | WP_104988035.1 | MFS transporter | - |
| CTZ23_RS00855 (CTZ23_00855) | ssb | 187126..187692 (+) | 567 | WP_045795510.1 | single-stranded DNA-binding protein | Machinery gene |
| CTZ23_RS00860 (CTZ23_00860) | - | 187849..189072 (+) | 1224 | WP_104988036.1 | site-specific integrase | - |
| CTZ23_RS00865 (CTZ23_00865) | - | 189069..189437 (+) | 369 | WP_227543023.1 | hypothetical protein | - |
| CTZ23_RS00875 (CTZ23_00875) | - | 189485..190704 (+) | 1220 | WP_104988037.1 | IS3 family transposase | - |
| CTZ23_RS00880 (CTZ23_00880) | - | 190743..191936 (+) | 1194 | Protein_170 | site-specific integrase | - |
| CTZ23_RS00885 (CTZ23_00885) | - | 191929..194052 (+) | 2124 | WP_104988038.1 | integrase | - |
| CTZ23_RS00890 (CTZ23_00890) | - | 194054..194473 (+) | 420 | WP_104988039.1 | hypothetical protein | - |
| CTZ23_RS00895 (CTZ23_00895) | - | 194676..195716 (+) | 1041 | WP_016658839.1 | IS481 family transposase | - |
| CTZ23_RS00900 (CTZ23_00900) | - | 195748..196242 (-) | 495 | WP_227543024.1 | hypothetical protein | - |
| CTZ23_RS00905 (CTZ23_00905) | - | 196339..196554 (+) | 216 | WP_019385588.1 | helix-turn-helix domain-containing protein | - |
| CTZ23_RS00910 (CTZ23_00910) | - | 196672..197762 (+) | 1091 | Protein_176 | IS3 family transposase | - |
| CTZ23_RS00915 (CTZ23_00915) | - | 197888..198928 (-) | 1041 | WP_016658839.1 | IS481 family transposase | - |
| CTZ23_RS00920 (CTZ23_00920) | - | 199022..199222 (-) | 201 | WP_104988041.1 | hypothetical protein | - |
| CTZ23_RS00925 (CTZ23_00925) | - | 199246..200166 (-) | 921 | WP_104988042.1 | copper resistance protein B | - |
| CTZ23_RS00930 (CTZ23_00930) | - | 200153..201775 (-) | 1623 | Protein_180 | copper resistance system multicopper oxidase | - |
| CTZ23_RS00940 (CTZ23_00940) | - | 203084..203320 (-) | 237 | Protein_182 | multicopper oxidase domain-containing protein | - |
| CTZ23_RS00945 (CTZ23_00945) | - | 203410..203706 (-) | 297 | WP_005021637.1 | hypothetical protein | - |
| CTZ23_RS00950 (CTZ23_00950) | - | 203855..204535 (+) | 681 | WP_004679347.1 | heavy metal response regulator transcription factor | - |
| CTZ23_RS00955 (CTZ23_00955) | - | 204528..205928 (+) | 1401 | WP_005180715.1 | heavy metal sensor histidine kinase | - |
| CTZ23_RS00960 (CTZ23_00960) | - | 205967..207250 (-) | 1284 | WP_004663995.1 | MgtC/SapB family protein | - |
| CTZ23_RS00965 (CTZ23_00965) | - | 207247..209622 (-) | 2376 | WP_005105854.1 | heavy metal translocating P-type ATPase | - |
| CTZ23_RS00975 (CTZ23_00975) | - | 209634..210284 (-) | 651 | Protein_188 | methyltransferase family protein | - |
| CTZ23_RS00980 (CTZ23_00980) | - | 210305..210553 (-) | 249 | WP_004695740.1 | DUF2933 domain-containing protein | - |
| CTZ23_RS00985 (CTZ23_00985) | - | 210580..211011 (-) | 432 | WP_005105848.1 | hypothetical protein | - |
| CTZ23_RS00990 (CTZ23_00990) | - | 211376..211756 (+) | 381 | WP_004681441.1 | copper resistance protein CopC | - |
| CTZ23_RS00995 (CTZ23_00995) | - | 211821..212702 (+) | 882 | WP_104988044.1 | copper resistance D family protein | - |
| CTZ23_RS01000 (CTZ23_01000) | - | 213172..213366 (+) | 195 | WP_004281879.1 | heavy-metal-associated domain-containing protein | - |
| CTZ23_RS01005 (CTZ23_01005) | - | 213538..214242 (-) | 705 | WP_104988045.1 | IS6-like element IS1006 family transposase | - |
| CTZ23_RS01010 (CTZ23_01010) | - | 214306..215586 (-) | 1281 | WP_104989331.1 | cation transporter | - |
| CTZ23_RS01015 (CTZ23_01015) | cadR | 215676..216068 (+) | 393 | WP_000550240.1 | Cd(II)/Pb(II)-responsive transcriptional regulator | - |
| CTZ23_RS01020 (CTZ23_01020) | - | 216162..216323 (+) | 162 | Protein_197 | IS6 family transposase | - |
| CTZ23_RS01025 (CTZ23_01025) | - | 216365..216667 (-) | 303 | WP_001140620.1 | helix-turn-helix domain-containing protein | - |
| CTZ23_RS01030 (CTZ23_01030) | - | 216660..216857 (-) | 198 | Protein_199 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| CTZ23_RS01035 (CTZ23_01035) | - | 216896..217875 (-) | 980 | Protein_200 | IS3 family transposase | - |
| CTZ23_RS01040 (CTZ23_01040) | - | 217928..219147 (+) | 1220 | WP_104988037.1 | IS3 family transposase | - |
| CTZ23_RS01045 (CTZ23_01045) | - | 219169..219282 (-) | 114 | Protein_202 | transposase | - |
| CTZ23_RS01050 (CTZ23_01050) | - | 219615..219983 (+) | 369 | WP_104988046.1 | cation efflux protein, CzcI-like | - |
| CTZ23_RS01055 (CTZ23_01055) | - | 220032..221357 (+) | 1326 | WP_104988047.1 | TolC family protein | - |
| CTZ23_RS01060 (CTZ23_01060) | - | 221359..222588 (+) | 1230 | WP_104988048.1 | efflux RND transporter periplasmic adaptor subunit | - |
| CTZ23_RS01065 (CTZ23_01065) | - | 222578..225718 (+) | 3141 | WP_104988049.1 | efflux RND transporter permease subunit | - |
| CTZ23_RS01070 (CTZ23_01070) | - | 225805..226704 (+) | 900 | WP_104988050.1 | cation diffusion facilitator family transporter | - |
| CTZ23_RS01075 (CTZ23_01075) | - | 226888..227481 (+) | 594 | WP_104988051.1 | recombinase family protein | - |
| CTZ23_RS01080 (CTZ23_01080) | - | 227544..228650 (-) | 1107 | WP_104988052.1 | ImmA/IrrE family metallo-endopeptidase | - |
| CTZ23_RS01085 (CTZ23_01085) | - | 228663..229373 (-) | 711 | WP_104988053.1 | hypothetical protein | - |
| CTZ23_RS01095 (CTZ23_01095) | - | 229907..230977 (+) | 1071 | WP_104988054.1 | hypothetical protein | - |
| CTZ23_RS01100 (CTZ23_01100) | - | 231005..231709 (-) | 705 | WP_104988045.1 | IS6-like element IS1006 family transposase | - |
| CTZ23_RS01105 (CTZ23_01105) | - | 231776..232750 (-) | 975 | WP_019838459.1 | calcium/sodium antiporter | - |
| CTZ23_RS01110 (CTZ23_01110) | - | 232978..233682 (+) | 705 | WP_001067784.1 | IS6-like element IS1006 family transposase | - |
| CTZ23_RS01115 (CTZ23_01115) | - | 233882..234160 (+) | 279 | WP_104988055.1 | hypothetical protein | - |
| CTZ23_RS01120 (CTZ23_01120) | - | 234256..235128 (+) | 873 | WP_104988056.1 | restriction endonuclease | - |
| CTZ23_RS01125 (CTZ23_01125) | - | 235318..235569 (+) | 252 | WP_104988057.1 | DUF4041 domain-containing protein | - |
| CTZ23_RS01135 (CTZ23_01135) | - | 236454..238319 (+) | 1866 | WP_104988058.1 | copper resistance system multicopper oxidase | - |
| CTZ23_RS01140 (CTZ23_01140) | - | 238306..238644 (+) | 339 | WP_104988059.1 | hypothetical protein | - |
| CTZ23_RS01145 (CTZ23_01145) | - | 238631..239575 (+) | 945 | WP_004668309.1 | copper resistance protein B | - |
| CTZ23_RS01150 (CTZ23_01150) | - | 239755..240000 (+) | 246 | WP_104988060.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| CTZ23_RS01155 (CTZ23_01155) | - | 239990..240283 (+) | 294 | WP_000221358.1 | type II toxin-antitoxin system RelE family toxin | - |
| CTZ23_RS01160 (CTZ23_01160) | - | 240322..241473 (-) | 1152 | WP_005176703.1 | IS4-like element ISAbe18 family transposase | - |
| CTZ23_RS01165 (CTZ23_01165) | - | 241691..242020 (-) | 330 | WP_004641881.1 | four-helix bundle copper-binding protein | - |
| CTZ23_RS01175 (CTZ23_01170) | - | 242284..243216 (-) | 933 | WP_104988061.1 | IS5 family transposase | - |
| CTZ23_RS01180 (CTZ23_01175) | - | 243270..243785 (+) | 516 | Protein_226 | IS3 family transposase | - |
Sequence
Protein
Download Length: 188 a.a. Molecular weight: 20667.41 Da Isoelectric Point: 6.4819
>NTDB_id=254419 CTZ23_RS00855 WP_045795510.1 187126..187692(+) (ssb) [Acinetobacter indicus strain SGAir0564]
MRGVNKVILVGTLGRDPETKTFPNGGSLTQFSIATSDAWTDKTTGERKEQTEWHRIVLHNRLGEIAQQYLRKGSKVYIEG
SLRTRQWTDQNGQERYTTEIRGEQMQMLDSGRQQGEQGDNGFNQPRFNNNQGGGYSNNNQGGYAPQAQGGFNNNNAGGGY
GNQGGYQQPKPAPAATPAPADLDDDLPF
MRGVNKVILVGTLGRDPETKTFPNGGSLTQFSIATSDAWTDKTTGERKEQTEWHRIVLHNRLGEIAQQYLRKGSKVYIEG
SLRTRQWTDQNGQERYTTEIRGEQMQMLDSGRQQGEQGDNGFNQPRFNNNQGGGYSNNNQGGYAPQAQGGFNNNNAGGGY
GNQGGYQQPKPAPAATPAPADLDDDLPF
Nucleotide
Download Length: 567 bp
>NTDB_id=254419 CTZ23_RS00855 WP_045795510.1 187126..187692(+) (ssb) [Acinetobacter indicus strain SGAir0564]
ATGCGTGGTGTAAATAAGGTCATTTTAGTTGGTACTTTAGGTCGAGATCCAGAAACAAAAACTTTCCCGAATGGTGGCTC
GCTTACTCAATTTTCCATTGCCACCAGTGATGCGTGGACCGATAAAACCACCGGTGAGCGTAAAGAGCAAACCGAATGGC
ACCGTATTGTGCTGCATAACCGTTTAGGTGAAATCGCGCAGCAATACTTACGCAAAGGATCAAAAGTCTATATTGAAGGT
TCATTACGTACCCGTCAGTGGACCGATCAGAATGGTCAGGAACGCTACACCACAGAAATTCGTGGCGAGCAAATGCAGAT
GCTGGACTCTGGTCGTCAGCAAGGTGAGCAGGGCGATAACGGATTTAACCAGCCGCGTTTTAACAATAACCAGGGCGGTG
GTTATAGCAATAACAACCAGGGTGGCTATGCGCCGCAGGCTCAAGGCGGTTTTAACAACAATAATGCTGGTGGTGGCTAT
GGCAACCAGGGCGGTTATCAGCAACCGAAACCAGCTCCTGCTGCAACGCCTGCACCGGCAGATTTGGATGATGACTTACC
GTTTTAG
ATGCGTGGTGTAAATAAGGTCATTTTAGTTGGTACTTTAGGTCGAGATCCAGAAACAAAAACTTTCCCGAATGGTGGCTC
GCTTACTCAATTTTCCATTGCCACCAGTGATGCGTGGACCGATAAAACCACCGGTGAGCGTAAAGAGCAAACCGAATGGC
ACCGTATTGTGCTGCATAACCGTTTAGGTGAAATCGCGCAGCAATACTTACGCAAAGGATCAAAAGTCTATATTGAAGGT
TCATTACGTACCCGTCAGTGGACCGATCAGAATGGTCAGGAACGCTACACCACAGAAATTCGTGGCGAGCAAATGCAGAT
GCTGGACTCTGGTCGTCAGCAAGGTGAGCAGGGCGATAACGGATTTAACCAGCCGCGTTTTAACAATAACCAGGGCGGTG
GTTATAGCAATAACAACCAGGGTGGCTATGCGCCGCAGGCTCAAGGCGGTTTTAACAACAATAATGCTGGTGGTGGCTAT
GGCAACCAGGGCGGTTATCAGCAACCGAAACCAGCTCCTGCTGCAACGCCTGCACCGGCAGATTTGGATGATGACTTACC
GTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
53.646 |
100 |
0.548 |
| ssb | Vibrio cholerae strain A1552 |
43.939 |
100 |
0.463 |
| ssb | Neisseria meningitidis MC58 |
38.421 |
100 |
0.388 |
| ssb | Neisseria gonorrhoeae MS11 |
38.421 |
100 |
0.388 |