Detailed information NTG0254307

Bioinformatically predicted

Overview

• Name: ssb
• Type: Machinery gene
• Locus tag: CTZ18_RS14365
• Genome accession: NZ_CP024612
• Coordinates: 2951535..2951861 (-)
• Length: 108 a.a.
• NCBI ID: WP_058222113.1
• Uniprot ID: -
• Organism: Acinetobacter baumannii strain Ab4653
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	2937746..2956511	2951535..2951861	within	0

Gene organization within MGE regions

Location: 2937746..2956511

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
CTZ18_RS14295 (CTZ18_14275)	-	2937746..2939092 (+)	1347	WP_001046209.1	OprD family outer membrane porin	-
CTZ18_RS14305 (CTZ18_14285)	-	2939739..2940023 (+)	285	WP_000675273.1	hypothetical protein	-
CTZ18_RS14310 (CTZ18_14290)	-	2940304..2940606 (+)	303	WP_000020972.1	hypothetical protein	-
CTZ18_RS14315 (CTZ18_14295)	-	2940611..2941078 (-)	468	Protein_2770	hypothetical protein	-
CTZ18_RS14320 (CTZ18_14300)	-	2941147..2942237 (+)	1091	WP_085940413.1	IS4-like element ISAba1 family transposase	-
CTZ18_RS14325 (CTZ18_14305)	-	2942253..2942750 (-)	498	Protein_2772	hypothetical protein	-
CTZ18_RS14335 (CTZ18_14315)	-	2943141..2944004 (-)	864	WP_000109893.1	DNA adenine methylase	-
CTZ18_RS14340 (CTZ18_14320)	-	2944069..2945790 (-)	1722	WP_000203259.1	AAA family ATPase	-
CTZ18_RS14345 (CTZ18_14325)	-	2947860..2948549 (-)	690	WP_068523863.1	hypothetical protein	-
CTZ18_RS14350 (CTZ18_14330)	-	2949196..2950302 (+)	1107	WP_032023363.1	hypothetical protein	-
CTZ18_RS14355 (CTZ18_14335)	-	2950310..2950759 (+)	450	WP_032023364.1	hypothetical protein	-
CTZ18_RS14360 (CTZ18_14340)	-	2950794..2951456 (+)	663	WP_223154297.1	hypothetical protein	-
CTZ18_RS14365 (CTZ18_14345)	ssb	2951535..2951861 (-)	327	WP_058222113.1	single-stranded DNA-binding protein	Machinery gene
CTZ18_RS14370 (CTZ18_14350)	-	2952194..2954659 (-)	2466	WP_086377480.1	DUF927 domain-containing protein	-
CTZ18_RS14375 (CTZ18_14355)	-	2954672..2954950 (-)	279	WP_001064707.1	hypothetical protein	-
CTZ18_RS14380 (CTZ18_14360)	-	2955075..2955380 (-)	306	WP_000787149.1	hypothetical protein	-
CTZ18_RS14385 (CTZ18_14365)	-	2955390..2955758 (-)	369	WP_001046481.1	hypothetical protein	-
CTZ18_RS14390 (CTZ18_14370)	-	2955751..2956305 (-)	555	WP_001988245.1	Bro-N domain-containing protein	-
CTZ18_RS14395 (CTZ18_14375)	-	2956302..2956511 (-)	210	WP_001016479.1	helix-turn-helix domain-containing protein	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 12194.96 Da
• Isoelectric Point: 10.3517

>NTDB_id=254307 CTZ18_RS14365 WP_058222113.1 2951535..2951861(-) (ssb) [Acinetobacter baumannii strain Ab4653]
MPNVKKVTVMGVLGLNPETKQFSNGGSVTTFSVATTEFWKDKTTGERKEATEWHRITTSNRLAEIASKYLKKGGKVYIEG
SLRTRKWKDSKGAEKEITEIRADEMQLL

Nucleotide

• Length: 327 bp

>NTDB_id=254307 CTZ18_RS14365 WP_058222113.1 2951535..2951861(-) (ssb) [Acinetobacter baumannii strain Ab4653]
ATGCCAAACGTAAAGAAAGTTACTGTCATGGGTGTGTTAGGTCTTAACCCTGAAACTAAACAATTTTCCAACGGTGGCAG
CGTTACGACATTCAGCGTTGCAACTACTGAGTTTTGGAAAGACAAGACCACAGGTGAGCGTAAAGAAGCTACAGAGTGGC
ATAGAATCACCACCAGCAACCGTTTAGCCGAGATTGCCAGTAAGTACCTCAAGAAAGGCGGAAAGGTGTATATCGAAGGC
TCATTGCGTACAAGGAAGTGGAAGGACAGCAAAGGGGCGGAAAAGGAAATAACCGAGATTCGAGCAGATGAGATGCAATT
GCTTTGA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (4-108)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssb	Glaesserella parasuis strain SC1401	52.778	100	0.528
ssb	Neisseria gonorrhoeae MS11	48.113	98.148	0.472
ssb	Neisseria meningitidis MC58	48.113	98.148	0.472
ssb	Vibrio cholerae strain A1552	51.546	89.815	0.463