Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   A388_RS03130 Genome accession   NZ_CP024418
Coordinates   605013..605366 (-) Length   117 a.a.
NCBI ID   WP_059262579.1    Uniprot ID   -
Organism   Acinetobacter baumannii strain A388     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 602647..635616 605013..605366 within 0


Gene organization within MGE regions


Location: 602647..635616
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A388_RS03110 (A388_00590) - 602647..603714 (+) 1068 WP_059262584.1 tyrosine-type recombinase/integrase -
  A388_RS03115 (A388_00591) - 603742..604038 (-) 297 WP_000218943.1 hypothetical protein -
  A388_RS03120 (A388_00592) - 604035..604256 (-) 222 WP_059262583.1 hypothetical protein -
  A388_RS03125 (A388_00593) - 604266..605003 (-) 738 WP_059262581.1 3'-5' exonuclease -
  A388_RS03130 (A388_00594) ssb 605013..605366 (-) 354 WP_059262579.1 single-stranded DNA-binding protein Machinery gene
  A388_RS03135 (A388_00595) - 605354..605671 (-) 318 WP_000049862.1 hypothetical protein -
  A388_RS03140 (A388_00596) - 605675..606193 (-) 519 WP_005136254.1 hypothetical protein -
  A388_RS03145 (A388_00597) - 606196..606627 (-) 432 WP_001178667.1 DUF2528 family protein -
  A388_RS03150 (A388_00598) - 606695..607030 (-) 336 WP_057097136.1 hypothetical protein -
  A388_RS03155 (A388_00599) - 607027..609765 (-) 2739 WP_059262576.1 toprim domain-containing protein -
  A388_RS03160 (A388_00600) - 609859..610050 (-) 192 WP_032040900.1 hypothetical protein -
  A388_RS03165 (A388_00601) - 610143..610484 (+) 342 WP_000786717.1 helix-turn-helix domain-containing protein -
  A388_RS03170 (A388_00602) - 610529..610744 (-) 216 WP_000556347.1 hypothetical protein -
  A388_RS03175 (A388_00603) - 610845..611090 (-) 246 WP_000789360.1 hypothetical protein -
  A388_RS03180 (A388_00604) - 611093..611287 (-) 195 WP_057097134.1 hypothetical protein -
  A388_RS03190 (A388_00607) - 612791..613525 (+) 735 WP_000190074.1 hypothetical protein -
  A388_RS03195 (A388_00608) - 613597..614343 (+) 747 WP_059262828.1 hypothetical protein -
  A388_RS03205 (A388_00609) - 614654..614854 (-) 201 WP_000130087.1 TraR/DksA C4-type zinc finger protein -
  A388_RS03210 (A388_00610) - 614851..615090 (-) 240 WP_000113724.1 ogr/Delta-like zinc finger family protein -
  A388_RS03215 (A388_00611) - 615220..616533 (-) 1314 WP_059262830.1 contractile injection system protein, VgrG/Pvc8 family -
  A388_RS03220 (A388_00612) - 616534..616974 (-) 441 WP_000979754.1 phage tail protein -
  A388_RS03225 (A388_00613) - 616980..619520 (-) 2541 WP_059262832.1 phage tail tape measure protein -
  A388_RS03230 - 619534..619671 (-) 138 WP_099527947.1 GpE family phage tail protein -
  A388_RS03235 (A388_00614) - 619674..620015 (-) 342 WP_059262834.1 phage tail assembly protein -
  A388_RS03240 (A388_00615) - 620083..620601 (-) 519 WP_032013880.1 phage major tail tube protein -
  A388_RS03245 (A388_00616) - 620614..621789 (-) 1176 WP_059262837.1 phage tail sheath protein -
  A388_RS03250 (A388_00617) - 621895..624351 (-) 2457 WP_059262839.1 phage tail protein -
  A388_RS03255 (A388_00618) - 624354..624962 (-) 609 WP_059262842.1 phage tail protein I -
  A388_RS03260 (A388_00619) - 624962..625864 (-) 903 WP_059262844.1 baseplate J/gp47 family protein -
  A388_RS03265 (A388_00620) - 625861..626208 (-) 348 WP_059262846.1 GPW/gp25 family protein -
  A388_RS03270 (A388_00621) - 626205..626831 (-) 627 WP_059262847.1 phage baseplate assembly protein V -
  A388_RS03275 (A388_00622) - 626904..627353 (-) 450 WP_059262849.1 phage virion morphogenesis protein -
  A388_RS03280 (A388_00623) - 627350..627877 (-) 528 WP_059262851.1 phage tail protein -
  A388_RS03285 (A388_00624) - 627874..628704 (-) 831 WP_059262853.1 N-acetylmuramidase domain-containing protein -
  A388_RS03290 (A388_00625) - 628701..628970 (-) 270 WP_000571491.1 phage holin family protein -
  A388_RS03295 (A388_00626) - 628967..629317 (-) 351 WP_001114936.1 putative holin -
  A388_RS03300 (A388_00627) - 629326..629535 (-) 210 WP_059262855.1 tail protein X -
  A388_RS03305 (A388_00628) - 629536..629988 (-) 453 WP_059262857.1 head completion/stabilization protein -
  A388_RS03310 (A388_00629) gpM 630091..630792 (-) 702 WP_059262859.1 phage terminase small subunit -
  A388_RS03315 (A388_00630) - 630803..631792 (-) 990 WP_059262860.1 phage major capsid protein, P2 family -
  A388_RS03320 (A388_00631) - 631845..632672 (-) 828 WP_059262862.1 GPO family capsid scaffolding protein -
  A388_RS03325 (A388_00632) - 632831..634618 (+) 1788 WP_059262884.1 terminase large subunit domain-containing protein -
  A388_RS03330 (A388_00633) - 634618..635616 (+) 999 WP_059262864.1 phage portal protein -

Sequence

Protein


Download         Length: 117 a.a.        Molecular weight: 13290.99 Da        Isoelectric Point: 9.4650

>NTDB_id=253481 A388_RS03130 WP_059262579.1 605013..605366(-) (ssb) [Acinetobacter baumannii strain A388]
MRGINKVILVGVLGANPIPKQFQNGGSYAQFSIATSEKYQDKQTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQDRYVTEVRAITFQSLDSLPQANPV

Nucleotide


Download         Length: 354 bp        

>NTDB_id=253481 A388_RS03130 WP_059262579.1 605013..605366(-) (ssb) [Acinetobacter baumannii strain A388]
ATGCGCGGAATAAACAAAGTGATATTGGTCGGTGTGCTTGGTGCCAATCCAATTCCTAAACAGTTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACAAACTGGTGACTGGATTGAAAATACAGAGTGGC
ATCGTATTGTTGCCCACAACAGACTAGGAGAAATTGCCTGCCAATTTCTTAAAAAAGGTTCAAAAGTTTATATCGAAGGG
TCATTACATACACGGAAATGGACTGACCAAAACAATCAAGACCGTTACGTAACTGAAGTTAGAGCCATTACTTTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-106)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

56.364

94.017

0.53
  ssb Vibrio cholerae strain A1552

55.556

84.615

0.47
  ssb Neisseria gonorrhoeae MS11

40.952

89.744

0.368
  ssb Neisseria meningitidis MC58

40.952

89.744

0.368

Multiple sequence alignment