Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | CRT37_RS21005 | Genome accession | NZ_CP023834 |
| Coordinates | 4375238..4375774 (+) | Length | 178 a.a. |
| NCBI ID | WP_000168305.1 | Uniprot ID | A0A9P2PPK2 |
| Organism | Escherichia coli strain 4/2-1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 4351562..4396088 | 4375238..4375774 | within | 0 |
Gene organization within MGE regions
Location: 4351562..4396088
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CRT37_RS20895 (CRT37_22160) | - | 4351816..4353396 (+) | 1581 | Protein_4071 | SopA family protein | - |
| CRT37_RS20900 (CRT37_22170) | ubiC | 4353619..4354116 (+) | 498 | WP_001326644.1 | chorismate lyase | - |
| CRT37_RS20905 (CRT37_22175) | ubiA | 4354129..4355001 (+) | 873 | WP_000455227.1 | 4-hydroxybenzoate octaprenyltransferase | - |
| CRT37_RS20910 (CRT37_22180) | plsB | 4355156..4357579 (-) | 2424 | WP_000017354.1 | glycerol-3-phosphate 1-O-acyltransferase PlsB | - |
| CRT37_RS20915 (CRT37_22185) | dgkA | 4357750..4358118 (+) | 369 | WP_000002907.1 | diacylglycerol kinase | - |
| CRT37_RS20920 (CRT37_22190) | lexA | 4358228..4358836 (+) | 609 | WP_000646078.1 | transcriptional repressor LexA | - |
| CRT37_RS20925 (CRT37_22195) | dinF | 4358909..4360234 (+) | 1326 | WP_001326646.1 | MATE family efflux transporter DinF | - |
| CRT37_RS20930 (CRT37_22200) | yjbJ | 4360350..4360559 (+) | 210 | WP_001030593.1 | CsbD family protein | - |
| CRT37_RS20935 (CRT37_22205) | zur | 4360601..4361116 (-) | 516 | WP_001295691.1 | zinc uptake transcriptional repressor Zur | - |
| CRT37_RS24855 (CRT37_22210) | yjbL | 4361434..4361688 (+) | 255 | WP_000912571.1 | protein YjbL | - |
| CRT37_RS20945 (CRT37_22215) | yjbM | 4361712..4362419 (+) | 708 | WP_001311303.1 | DUF2713 domain-containing protein | - |
| CRT37_RS20950 (CRT37_22220) | dusA | 4362782..4363819 (+) | 1038 | WP_001298868.1 | tRNA dihydrouridine(20/20a) synthase DusA | - |
| CRT37_RS20955 (CRT37_22225) | pspG | 4363953..4364195 (+) | 243 | WP_000891404.1 | envelope stress response protein PspG | - |
| CRT37_RS20960 (CRT37_22230) | qorA | 4364361..4365344 (-) | 984 | WP_000235508.1 | quinone oxidoreductase | - |
| CRT37_RS20965 (CRT37_22235) | dnaB | 4365427..4366842 (+) | 1416 | WP_000918363.1 | replicative DNA helicase | - |
| CRT37_RS20970 (CRT37_22240) | alr | 4366895..4367974 (+) | 1080 | WP_001147328.1 | alanine racemase | - |
| CRT37_RS20975 (CRT37_22245) | tyrB | 4368227..4369420 (+) | 1194 | WP_000486985.1 | aromatic amino acid transaminase | - |
| CRT37_RS24370 (CRT37_22250) | yjbS | 4369922..4370125 (-) | 204 | WP_001321562.1 | protein YjbS | - |
| CRT37_RS20985 (CRT37_22255) | aphA | 4370527..4371240 (+) | 714 | WP_001226928.1 | acid phosphatase AphA | - |
| CRT37_RS20990 (CRT37_22260) | yjbQ | 4371351..4371767 (+) | 417 | WP_000270375.1 | secondary thiamine-phosphate synthase enzyme YjbQ | - |
| CRT37_RS20995 (CRT37_22265) | yjbR | 4371771..4372127 (+) | 357 | WP_000155657.1 | MmcQ/YjbR family DNA-binding protein | - |
| CRT37_RS21000 (CRT37_22270) | uvrA | 4372162..4374984 (-) | 2823 | WP_000357740.1 | excinuclease ABC subunit UvrA | - |
| CRT37_RS21005 (CRT37_22275) | ssb | 4375238..4375774 (+) | 537 | WP_000168305.1 | single-stranded DNA-binding protein SSB1 | Machinery gene |
| CRT37_RS21010 (CRT37_22280) | - | 4375933..4377180 (+) | 1248 | WP_000414651.1 | site-specific integrase | - |
| CRT37_RS21015 (CRT37_22285) | - | 4377167..4378705 (+) | 1539 | WP_001333349.1 | site-specific integrase | - |
| CRT37_RS21020 (CRT37_22290) | - | 4378722..4380755 (+) | 2034 | WP_000807722.1 | hypothetical protein | - |
| CRT37_RS24375 | - | 4380748..4381167 (+) | 420 | WP_001062122.1 | hypothetical protein | - |
| CRT37_RS21030 (CRT37_22300) | avs4 | 4381243..4386006 (+) | 4764 | WP_000240574.1 | AVAST type 4 anti-phage nuclease Avs4 | - |
| CRT37_RS21040 (CRT37_22310) | - | 4386545..4387366 (-) | 822 | WP_001272932.1 | abortive infection system antitoxin AbiGi family protein | - |
| CRT37_RS21045 (CRT37_22315) | yjcB | 4387774..4388055 (-) | 282 | WP_001295689.1 | YjcB family protein | - |
| CRT37_RS21050 (CRT37_22325) | pdeC | 4388485..4390071 (+) | 1587 | WP_059328862.1 | c-di-GMP phosphodiesterase PdeC | - |
| CRT37_RS21055 (CRT37_22330) | soxS | 4390074..4390397 (-) | 324 | WP_000019358.1 | superoxide response transcriptional regulator SoxS | - |
| CRT37_RS21060 (CRT37_22335) | soxR | 4390483..4390947 (+) | 465 | WP_000412430.1 | redox-sensitive transcriptional activator SoxR | - |
| CRT37_RS21065 (CRT37_22355) | ghxP | 4391493..4392842 (+) | 1350 | WP_000106882.1 | guanine/hypoxanthine transporter GhxP | - |
| CRT37_RS21070 (CRT37_22360) | yjcE | 4392993..4394642 (+) | 1650 | WP_000402207.1 | Na+/H+ antiporter | - |
| CRT37_RS21075 (CRT37_22365) | espX5 | 4394796..4396088 (-) | 1293 | WP_001270095.1 | T3SS effector pentapeptide repeat protein EspX5 | - |
Sequence
Protein
Download Length: 178 a.a. Molecular weight: 18975.00 Da Isoelectric Point: 5.2358
>NTDB_id=250427 CRT37_RS21005 WP_000168305.1 4375238..4375774(+) (ssb) [Escherichia coli strain 4/2-1]
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYI
EGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSA
PAAPSNEPPMDFDDDIPF
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYI
EGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSA
PAAPSNEPPMDFDDDIPF
Nucleotide
Download Length: 537 bp
>NTDB_id=250427 CRT37_RS21005 WP_000168305.1 4375238..4375774(+) (ssb) [Escherichia coli strain 4/2-1]
ATGGCCAGCAGAGGCGTAAACAAGGTTATTCTCGTTGGTAATCTGGGTCAGGACCCGGAAGTACGCTACATGCCAAATGG
TGGCGCAGTTGCCAACATTACGCTGGCTACTTCCGAATCCTGGCGTGATAAAGCGACCGGCGAGATGAAAGAACAGACTG
AATGGCACCGCGTTGTGCTGTTCGGCAAACTGGCAGAAGTGGCGAGCGAATATCTGCGTAAAGGTTCTCAGGTTTATATC
GAAGGTCAGCTGCGTACCCGTAAATGGACCGATCAATCCGGTCAGGATCGCTACACCACAGAAGTCGTGGTGAACGTTGG
CGGCACCATGCAGATGCTGGGTGGTCGTCAGGGTGGTGGCGCTCCGGCAGGTGGCAATATCGGTGGTGGTCAGCCGCAGG
GCGGTTGGGGTCAGCCTCAGCAGCCGCAGGGTGGCAATCAGTTCAGCGGCGGCGCGCAGTCTCGCCCGCAGCAGTCCGCT
CCGGCAGCGCCGTCTAACGAGCCGCCGATGGACTTTGATGATGACATTCCGTTCTAG
ATGGCCAGCAGAGGCGTAAACAAGGTTATTCTCGTTGGTAATCTGGGTCAGGACCCGGAAGTACGCTACATGCCAAATGG
TGGCGCAGTTGCCAACATTACGCTGGCTACTTCCGAATCCTGGCGTGATAAAGCGACCGGCGAGATGAAAGAACAGACTG
AATGGCACCGCGTTGTGCTGTTCGGCAAACTGGCAGAAGTGGCGAGCGAATATCTGCGTAAAGGTTCTCAGGTTTATATC
GAAGGTCAGCTGCGTACCCGTAAATGGACCGATCAATCCGGTCAGGATCGCTACACCACAGAAGTCGTGGTGAACGTTGG
CGGCACCATGCAGATGCTGGGTGGTCGTCAGGGTGGTGGCGCTCCGGCAGGTGGCAATATCGGTGGTGGTCAGCCGCAGG
GCGGTTGGGGTCAGCCTCAGCAGCCGCAGGGTGGCAATCAGTTCAGCGGCGGCGCGCAGTCTCGCCCGCAGCAGTCCGCT
CCGGCAGCGCCGTCTAACGAGCCGCCGATGGACTTTGATGATGACATTCCGTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
74.444 |
100 |
0.753 |
| ssb | Glaesserella parasuis strain SC1401 |
57.923 |
100 |
0.596 |
| ssb | Neisseria meningitidis MC58 |
48.066 |
100 |
0.489 |
| ssb | Neisseria gonorrhoeae MS11 |
48.066 |
100 |
0.489 |