Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   CQJ38_RS11975 Genome accession   NZ_CP023748
Coordinates   2454128..2454565 (-) Length   145 a.a.
NCBI ID   WP_012117983.1    Uniprot ID   -
Organism   Bacillus velezensis strain LABIM40     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2449128..2459565
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CQJ38_RS11925 (CQJ38_11925) sinI 2449512..2449685 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  CQJ38_RS11930 (CQJ38_11930) sinR 2449719..2450054 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CQJ38_RS11935 (CQJ38_11935) tasA 2450102..2450887 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  CQJ38_RS11940 (CQJ38_11940) sipW 2450952..2451536 (-) 585 WP_015240205.1 signal peptidase I SipW -
  CQJ38_RS11945 (CQJ38_11945) tapA 2451508..2452179 (-) 672 WP_063094776.1 amyloid fiber anchoring/assembly protein TapA -
  CQJ38_RS11950 (CQJ38_11950) - 2452438..2452767 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  CQJ38_RS11955 (CQJ38_11955) - 2452807..2452986 (-) 180 WP_003153093.1 YqzE family protein -
  CQJ38_RS11960 (CQJ38_11960) comGG 2453043..2453420 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  CQJ38_RS11965 (CQJ38_11965) comGF 2453421..2453921 (-) 501 WP_254895460.1 competence type IV pilus minor pilin ComGF -
  CQJ38_RS11970 (CQJ38_11970) comGE 2453830..2454144 (-) 315 WP_080130386.1 competence type IV pilus minor pilin ComGE Machinery gene
  CQJ38_RS11975 (CQJ38_11975) comGD 2454128..2454565 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  CQJ38_RS11980 (CQJ38_11980) comGC 2454555..2454863 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  CQJ38_RS11985 (CQJ38_11985) comGB 2454868..2455905 (-) 1038 WP_098081583.1 competence type IV pilus assembly protein ComGB Machinery gene
  CQJ38_RS11990 (CQJ38_11990) comGA 2455892..2456962 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  CQJ38_RS11995 (CQJ38_11995) - 2457155..2458105 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  CQJ38_RS12000 (CQJ38_12000) - 2458251..2459552 (+) 1302 WP_063094766.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16286.74 Da        Isoelectric Point: 10.2475

>NTDB_id=249695 CQJ38_RS11975 WP_012117983.1 2454128..2454565(-) (comGD) [Bacillus velezensis strain LABIM40]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=249695 CQJ38_RS11975 WP_012117983.1 2454128..2454565(-) (comGD) [Bacillus velezensis strain LABIM40]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACAACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.849

100

0.572


Multiple sequence alignment