Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | CQJ38_RS11925 | Genome accession | NZ_CP023748 |
| Coordinates | 2449512..2449685 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain LABIM40 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2444512..2454685
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CQJ38_RS11910 (CQJ38_11910) | gcvT | 2445325..2446425 (-) | 1101 | WP_015388009.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| CQJ38_RS11915 (CQJ38_11915) | - | 2446849..2448519 (+) | 1671 | WP_025284995.1 | DEAD/DEAH box helicase | - |
| CQJ38_RS11920 (CQJ38_11920) | - | 2448541..2449335 (+) | 795 | WP_098081582.1 | YqhG family protein | - |
| CQJ38_RS11925 (CQJ38_11925) | sinI | 2449512..2449685 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| CQJ38_RS11930 (CQJ38_11930) | sinR | 2449719..2450054 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| CQJ38_RS11935 (CQJ38_11935) | tasA | 2450102..2450887 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| CQJ38_RS11940 (CQJ38_11940) | sipW | 2450952..2451536 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| CQJ38_RS11945 (CQJ38_11945) | tapA | 2451508..2452179 (-) | 672 | WP_063094776.1 | amyloid fiber anchoring/assembly protein TapA | - |
| CQJ38_RS11950 (CQJ38_11950) | - | 2452438..2452767 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| CQJ38_RS11955 (CQJ38_11955) | - | 2452807..2452986 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| CQJ38_RS11960 (CQJ38_11960) | comGG | 2453043..2453420 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| CQJ38_RS11965 (CQJ38_11965) | comGF | 2453421..2453921 (-) | 501 | WP_254895460.1 | competence type IV pilus minor pilin ComGF | - |
| CQJ38_RS11970 (CQJ38_11970) | comGE | 2453830..2454144 (-) | 315 | WP_080130386.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| CQJ38_RS11975 (CQJ38_11975) | comGD | 2454128..2454565 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=249691 CQJ38_RS11925 WP_003153105.1 2449512..2449685(+) (sinI) [Bacillus velezensis strain LABIM40]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=249691 CQJ38_RS11925 WP_003153105.1 2449512..2449685(+) (sinI) [Bacillus velezensis strain LABIM40]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |