Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   CQJ38_RS11925 Genome accession   NZ_CP023748
Coordinates   2449512..2449685 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain LABIM40     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2444512..2454685
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CQJ38_RS11910 (CQJ38_11910) gcvT 2445325..2446425 (-) 1101 WP_015388009.1 glycine cleavage system aminomethyltransferase GcvT -
  CQJ38_RS11915 (CQJ38_11915) - 2446849..2448519 (+) 1671 WP_025284995.1 DEAD/DEAH box helicase -
  CQJ38_RS11920 (CQJ38_11920) - 2448541..2449335 (+) 795 WP_098081582.1 YqhG family protein -
  CQJ38_RS11925 (CQJ38_11925) sinI 2449512..2449685 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  CQJ38_RS11930 (CQJ38_11930) sinR 2449719..2450054 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CQJ38_RS11935 (CQJ38_11935) tasA 2450102..2450887 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  CQJ38_RS11940 (CQJ38_11940) sipW 2450952..2451536 (-) 585 WP_015240205.1 signal peptidase I SipW -
  CQJ38_RS11945 (CQJ38_11945) tapA 2451508..2452179 (-) 672 WP_063094776.1 amyloid fiber anchoring/assembly protein TapA -
  CQJ38_RS11950 (CQJ38_11950) - 2452438..2452767 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  CQJ38_RS11955 (CQJ38_11955) - 2452807..2452986 (-) 180 WP_003153093.1 YqzE family protein -
  CQJ38_RS11960 (CQJ38_11960) comGG 2453043..2453420 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  CQJ38_RS11965 (CQJ38_11965) comGF 2453421..2453921 (-) 501 WP_254895460.1 competence type IV pilus minor pilin ComGF -
  CQJ38_RS11970 (CQJ38_11970) comGE 2453830..2454144 (-) 315 WP_080130386.1 competence type IV pilus minor pilin ComGE Machinery gene
  CQJ38_RS11975 (CQJ38_11975) comGD 2454128..2454565 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=249691 CQJ38_RS11925 WP_003153105.1 2449512..2449685(+) (sinI) [Bacillus velezensis strain LABIM40]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=249691 CQJ38_RS11925 WP_003153105.1 2449512..2449685(+) (sinI) [Bacillus velezensis strain LABIM40]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment