Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   CLI97_RS02930 Genome accession   NZ_CP023320
Coordinates   538109..538486 (-) Length   125 a.a.
NCBI ID   WP_094247734.1    Uniprot ID   -
Organism   Bacillus velezensis strain SCGB     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 533109..543486
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CLI97_RS02890 (CLI97_00584) - 533608..534402 (+) 795 WP_014305407.1 YqhG family protein -
  CLI97_RS02895 (CLI97_00585) sinI 534579..534752 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  CLI97_RS02900 (CLI97_00586) sinR 534786..535121 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CLI97_RS02905 (CLI97_00587) tasA 535169..535954 (-) 786 WP_094247735.1 biofilm matrix protein TasA -
  CLI97_RS02910 (CLI97_00588) sipW 536018..536602 (-) 585 WP_012117977.1 signal peptidase I SipW -
  CLI97_RS02915 (CLI97_00589) tapA 536574..537245 (-) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  CLI97_RS02920 (CLI97_00590) - 537504..537833 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  CLI97_RS02925 (CLI97_00591) - 537873..538052 (-) 180 WP_003153093.1 YqzE family protein -
  CLI97_RS02930 (CLI97_00592) comGG 538109..538486 (-) 378 WP_094247734.1 competence type IV pilus minor pilin ComGG Machinery gene
  CLI97_RS02935 (CLI97_00593) comGF 538487..538987 (-) 501 WP_227005764.1 competence type IV pilus minor pilin ComGF -
  CLI97_RS02940 (CLI97_00594) comGE 538896..539210 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  CLI97_RS02945 (CLI97_00595) comGD 539194..539631 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  CLI97_RS02950 (CLI97_00596) comGC 539621..539887 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  CLI97_RS02955 (CLI97_00597) comGB 539934..540971 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  CLI97_RS02960 (CLI97_00598) comGA 540958..542028 (-) 1071 WP_070082113.1 competence type IV pilus ATPase ComGA Machinery gene
  CLI97_RS02965 (CLI97_00599) - 542220..543170 (-) 951 WP_071391609.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14125.06 Da        Isoelectric Point: 9.8061

>NTDB_id=246010 CLI97_RS02930 WP_094247734.1 538109..538486(-) (comGG) [Bacillus velezensis strain SCGB]
MHKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=246010 CLI97_RS02930 WP_094247734.1 538109..538486(-) (comGG) [Bacillus velezensis strain SCGB]
ATGCACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCACATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGCGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504

Multiple sequence alignment