Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   CLI97_RS02895 Genome accession   NZ_CP023320
Coordinates   534579..534752 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain SCGB     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 529579..539752
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CLI97_RS02880 (CLI97_00582) gcvT 530396..531496 (-) 1101 WP_094247736.1 glycine cleavage system aminomethyltransferase GcvT -
  CLI97_RS02885 (CLI97_00583) - 531920..533590 (+) 1671 WP_069013074.1 DEAD/DEAH box helicase -
  CLI97_RS02890 (CLI97_00584) - 533608..534402 (+) 795 WP_014305407.1 YqhG family protein -
  CLI97_RS02895 (CLI97_00585) sinI 534579..534752 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  CLI97_RS02900 (CLI97_00586) sinR 534786..535121 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CLI97_RS02905 (CLI97_00587) tasA 535169..535954 (-) 786 WP_094247735.1 biofilm matrix protein TasA -
  CLI97_RS02910 (CLI97_00588) sipW 536018..536602 (-) 585 WP_012117977.1 signal peptidase I SipW -
  CLI97_RS02915 (CLI97_00589) tapA 536574..537245 (-) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  CLI97_RS02920 (CLI97_00590) - 537504..537833 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  CLI97_RS02925 (CLI97_00591) - 537873..538052 (-) 180 WP_003153093.1 YqzE family protein -
  CLI97_RS02930 (CLI97_00592) comGG 538109..538486 (-) 378 WP_094247734.1 competence type IV pilus minor pilin ComGG Machinery gene
  CLI97_RS02935 (CLI97_00593) comGF 538487..538987 (-) 501 WP_227005764.1 competence type IV pilus minor pilin ComGF -
  CLI97_RS02940 (CLI97_00594) comGE 538896..539210 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  CLI97_RS02945 (CLI97_00595) comGD 539194..539631 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=246008 CLI97_RS02895 WP_003153105.1 534579..534752(+) (sinI) [Bacillus velezensis strain SCGB]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=246008 CLI97_RS02895 WP_003153105.1 534579..534752(+) (sinI) [Bacillus velezensis strain SCGB]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702

Multiple sequence alignment