Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   CK238_RS12150 Genome accession   NZ_CP023075
Coordinates   2454271..2454648 (-) Length   125 a.a.
NCBI ID   WP_017418138.1    Uniprot ID   -
Organism   Bacillus velezensis strain K26     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2449271..2459648
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CK238_RS12110 (CK238_12125) - 2449768..2450562 (+) 795 WP_014418368.1 YqhG family protein -
  CK238_RS12115 (CK238_12130) sinI 2450739..2450912 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  CK238_RS12120 (CK238_12135) sinR 2450946..2451281 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CK238_RS12125 (CK238_12140) - 2451329..2452114 (-) 786 WP_017418136.1 TasA family protein -
  CK238_RS12130 (CK238_12145) - 2452179..2452763 (-) 585 WP_014418370.1 signal peptidase I -
  CK238_RS12135 (CK238_12150) tapA 2452735..2453406 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  CK238_RS12140 (CK238_12155) - 2453665..2453994 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  CK238_RS12145 (CK238_12160) - 2454035..2454214 (-) 180 WP_003153093.1 YqzE family protein -
  CK238_RS12150 (CK238_12165) comGG 2454271..2454648 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  CK238_RS12155 (CK238_12170) comGF 2454649..2455044 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  CK238_RS12160 (CK238_12175) comGE 2455058..2455372 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  CK238_RS12165 (CK238_12180) comGD 2455356..2455793 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  CK238_RS12170 (CK238_12185) comGC 2455783..2456091 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  CK238_RS12175 (CK238_12190) comGB 2456096..2457133 (-) 1038 WP_053284924.1 competence type IV pilus assembly protein ComGB Machinery gene
  CK238_RS12180 (CK238_12195) comGA 2457120..2458190 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  CK238_RS12185 (CK238_12200) - 2458383..2459333 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14125.01 Da        Isoelectric Point: 9.7165

>NTDB_id=244775 CK238_RS12150 WP_017418138.1 2454271..2454648(-) (comGG) [Bacillus velezensis strain K26]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKGQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=244775 CK238_RS12150 WP_017418138.1 2454271..2454648(-) (comGG) [Bacillus velezensis strain K26]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGGCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCACCGGGAGTGATCGAAGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512


Multiple sequence alignment