Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | CK238_RS12115 | Genome accession | NZ_CP023075 |
| Coordinates | 2450739..2450912 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain K26 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2445739..2455912
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CK238_RS12100 (CK238_12115) | gcvT | 2446552..2447652 (-) | 1101 | WP_017418134.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| CK238_RS12105 (CK238_12120) | - | 2448076..2449746 (+) | 1671 | WP_021494309.1 | SNF2-related protein | - |
| CK238_RS12110 (CK238_12125) | - | 2449768..2450562 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| CK238_RS12115 (CK238_12130) | sinI | 2450739..2450912 (+) | 174 | WP_014418369.1 | anti-repressor SinI family protein | Regulator |
| CK238_RS12120 (CK238_12135) | sinR | 2450946..2451281 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| CK238_RS12125 (CK238_12140) | - | 2451329..2452114 (-) | 786 | WP_017418136.1 | TasA family protein | - |
| CK238_RS12130 (CK238_12145) | - | 2452179..2452763 (-) | 585 | WP_014418370.1 | signal peptidase I | - |
| CK238_RS12135 (CK238_12150) | tapA | 2452735..2453406 (-) | 672 | WP_025649852.1 | amyloid fiber anchoring/assembly protein TapA | - |
| CK238_RS12140 (CK238_12155) | - | 2453665..2453994 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| CK238_RS12145 (CK238_12160) | - | 2454035..2454214 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| CK238_RS12150 (CK238_12165) | comGG | 2454271..2454648 (-) | 378 | WP_017418138.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| CK238_RS12155 (CK238_12170) | comGF | 2454649..2455044 (-) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | - |
| CK238_RS12160 (CK238_12175) | comGE | 2455058..2455372 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| CK238_RS12165 (CK238_12180) | comGD | 2455356..2455793 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=244773 CK238_RS12115 WP_014418369.1 2450739..2450912(+) (sinI) [Bacillus velezensis strain K26]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=244773 CK238_RS12115 WP_014418369.1 2450739..2450912(+) (sinI) [Bacillus velezensis strain K26]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |