Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   CK238_RS12115 Genome accession   NZ_CP023075
Coordinates   2450739..2450912 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain K26     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2445739..2455912
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CK238_RS12100 (CK238_12115) gcvT 2446552..2447652 (-) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -
  CK238_RS12105 (CK238_12120) - 2448076..2449746 (+) 1671 WP_021494309.1 SNF2-related protein -
  CK238_RS12110 (CK238_12125) - 2449768..2450562 (+) 795 WP_014418368.1 YqhG family protein -
  CK238_RS12115 (CK238_12130) sinI 2450739..2450912 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  CK238_RS12120 (CK238_12135) sinR 2450946..2451281 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CK238_RS12125 (CK238_12140) - 2451329..2452114 (-) 786 WP_017418136.1 TasA family protein -
  CK238_RS12130 (CK238_12145) - 2452179..2452763 (-) 585 WP_014418370.1 signal peptidase I -
  CK238_RS12135 (CK238_12150) tapA 2452735..2453406 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  CK238_RS12140 (CK238_12155) - 2453665..2453994 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  CK238_RS12145 (CK238_12160) - 2454035..2454214 (-) 180 WP_003153093.1 YqzE family protein -
  CK238_RS12150 (CK238_12165) comGG 2454271..2454648 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  CK238_RS12155 (CK238_12170) comGF 2454649..2455044 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  CK238_RS12160 (CK238_12175) comGE 2455058..2455372 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  CK238_RS12165 (CK238_12180) comGD 2455356..2455793 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=244773 CK238_RS12115 WP_014418369.1 2450739..2450912(+) (sinI) [Bacillus velezensis strain K26]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=244773 CK238_RS12115 WP_014418369.1 2450739..2450912(+) (sinI) [Bacillus velezensis strain K26]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719


Multiple sequence alignment