Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | CGQ03_RS01860 | Genome accession | NZ_CP022905 |
| Coordinates | 399199..399702 (+) | Length | 167 a.a. |
| NCBI ID | WP_000934799.1 | Uniprot ID | A0A7U7IE99 |
| Organism | Staphylococcus aureus strain 628 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 395139..441524 | 399199..399702 | within | 0 |
Gene organization within MGE regions
Location: 395139..441524
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CGQ03_RS01825 (CGQ03_00330) | - | 395139..395984 (+) | 846 | WP_001557587.1 | ParB/RepB/Spo0J family partition protein | - |
| CGQ03_RS01830 (CGQ03_00331) | - | 396138..397019 (+) | 882 | WP_000373073.1 | mechanosensitive ion channel family protein | - |
| CGQ03_RS01835 (CGQ03_00332) | - | 397049..397252 (+) | 204 | WP_000157348.1 | DUF951 domain-containing protein | - |
| CGQ03_RS01840 (CGQ03_00333) | ychF | 397264..398361 (+) | 1098 | WP_001218732.1 | redox-regulated ATPase YchF | - |
| CGQ03_RS01845 (CGQ03_00334) | - | 398447..398638 (-) | 192 | WP_001052484.1 | hypothetical protein | - |
| CGQ03_RS01855 (CGQ03_00335) | rpsF | 398882..399178 (+) | 297 | WP_001261460.1 | 30S ribosomal protein S6 | - |
| CGQ03_RS01860 (CGQ03_00336) | ssbA | 399199..399702 (+) | 504 | WP_000934799.1 | single-stranded DNA-binding protein | Machinery gene |
| CGQ03_RS01865 (CGQ03_00337) | rpsR | 399754..399996 (+) | 243 | WP_000897044.1 | 30S ribosomal protein S18 | - |
| CGQ03_RS01870 (CGQ03_00338) | - | 400228..400947 (-) | 720 | WP_000400841.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| CGQ03_RS01875 (CGQ03_00339) | - | 401060..402274 (-) | 1215 | WP_000270135.1 | site-specific integrase | - |
| CGQ03_RS01880 (CGQ03_00340) | - | 402435..403058 (-) | 624 | WP_000230361.1 | helix-turn-helix transcriptional regulator | - |
| CGQ03_RS01885 (CGQ03_00341) | - | 403207..403371 (+) | 165 | WP_001611932.1 | helix-turn-helix domain-containing protein | - |
| CGQ03_RS01890 (CGQ03_00342) | - | 403372..403644 (+) | 273 | WP_031870322.1 | helix-turn-helix domain-containing protein | - |
| CGQ03_RS01895 (CGQ03_00343) | - | 403656..403829 (+) | 174 | WP_000784892.1 | hypothetical protein | - |
| CGQ03_RS01900 (CGQ03_00344) | - | 403796..403999 (+) | 204 | WP_001231376.1 | hypothetical protein | - |
| CGQ03_RS01905 (CGQ03_00345) | - | 404001..404384 (+) | 384 | WP_000403837.1 | hypothetical protein | - |
| CGQ03_RS01910 (CGQ03_00346) | - | 404385..404711 (+) | 327 | WP_001103967.1 | DUF1474 family protein | - |
| CGQ03_RS01915 (CGQ03_00347) | - | 404776..405645 (+) | 870 | WP_031870360.1 | primase alpha helix C-terminal domain-containing protein | - |
| CGQ03_RS01920 (CGQ03_00348) | - | 405657..407027 (+) | 1371 | WP_000151864.1 | DNA primase family protein | - |
| CGQ03_RS01925 (CGQ03_00349) | - | 407270..407626 (+) | 357 | WP_001059599.1 | hypothetical protein | - |
| CGQ03_RS01930 (CGQ03_00350) | - | 407628..407891 (+) | 264 | WP_001003076.1 | hypothetical protein | - |
| CGQ03_RS01935 (CGQ03_00351) | - | 407893..408534 (+) | 642 | WP_031870361.1 | pathogenicity island protein | - |
| CGQ03_RS01940 (CGQ03_00352) | - | 409242..409586 (+) | 345 | WP_001288442.1 | hypothetical protein | - |
| CGQ03_RS01945 (CGQ03_00353) | - | 409617..410270 (+) | 654 | WP_000214170.1 | hypothetical protein | - |
| CGQ03_RS01950 (CGQ03_00354) | - | 410323..410850 (+) | 528 | WP_031870369.1 | spore coat protein | - |
| CGQ03_RS01955 | - | 410982..411194 (+) | 213 | WP_001656917.1 | hypothetical protein | - |
| CGQ03_RS01960 (CGQ03_00356) | - | 411191..411760 (+) | 570 | WP_001293071.1 | terminase small subunit | - |
| CGQ03_RS15445 | - | 411807..411890 (+) | 84 | Protein_371 | terminase small subunit | - |
| CGQ03_RS01970 (CGQ03_00357) | - | 412037..413005 (+) | 969 | WP_000801980.1 | Abi family protein | - |
| CGQ03_RS01975 (CGQ03_00358) | - | 413147..413584 (+) | 438 | WP_073392942.1 | DUF3102 domain-containing protein | - |
| CGQ03_RS01980 (CGQ03_00359) | - | 413702..414214 (+) | 513 | WP_000813311.1 | hypothetical protein | - |
| CGQ03_RS15450 | - | 414230..414409 (+) | 180 | WP_000797954.1 | hypothetical protein | - |
| CGQ03_RS01995 (CGQ03_00360) | - | 414528..415700 (+) | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
| CGQ03_RS02000 (CGQ03_00361) | - | 416544..417482 (-) | 939 | WP_001817700.1 | Abi family protein | - |
| CGQ03_RS02005 | - | 417521..418234 (-) | 714 | Protein_378 | tyrosine-type recombinase/integrase | - |
| CGQ03_RS02010 (CGQ03_00362) | selX | 418440..419051 (+) | 612 | WP_000475325.1 | staphylococcal enterotoxin-like toxin X | - |
| CGQ03_RS02015 (CGQ03_00363) | - | 419420..419788 (+) | 369 | WP_000849163.1 | YxeA family protein | - |
| CGQ03_RS02020 (CGQ03_00364) | - | 419969..420541 (+) | 573 | WP_000769722.1 | PepSY domain-containing protein | - |
| CGQ03_RS02025 (CGQ03_00365) | - | 420678..420941 (-) | 264 | WP_001055897.1 | helix-turn-helix transcriptional regulator | - |
| CGQ03_RS02030 (CGQ03_00366) | - | 421241..421492 (+) | 252 | WP_000466748.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
| CGQ03_RS02035 | - | 421531..421740 (-) | 210 | WP_000211677.1 | hypothetical protein | - |
| CGQ03_RS02040 (CGQ03_00367) | - | 421918..422499 (+) | 582 | WP_000158375.1 | histidine phosphatase family protein | - |
| CGQ03_RS02045 (CGQ03_00368) | - | 422565..422948 (-) | 384 | WP_000868256.1 | hypothetical protein | - |
| CGQ03_RS02050 (CGQ03_00370) | - | 423218..423844 (-) | 627 | WP_000746679.1 | NDxxF motif lipoprotein | - |
| CGQ03_RS02055 (CGQ03_00371) | - | 423917..424135 (-) | 219 | Protein_388 | hypothetical protein | - |
| CGQ03_RS02060 (CGQ03_00372) | ahpF | 424288..425811 (-) | 1524 | WP_000930514.1 | alkyl hydroperoxide reductase subunit F | - |
| CGQ03_RS02065 (CGQ03_00373) | ahpC | 425827..426396 (-) | 570 | WP_000052781.1 | alkyl hydroperoxide reductase subunit C | - |
| CGQ03_RS02070 (CGQ03_00374) | nfsA | 426888..427643 (+) | 756 | WP_001287099.1 | oxygen-insensitive NADPH nitroreductase | - |
| CGQ03_RS02075 (CGQ03_00375) | - | 427723..429111 (-) | 1389 | WP_000991018.1 | L-cystine transporter | - |
| CGQ03_RS02080 | - | 429196..429294 (+) | 99 | WP_001792089.1 | hypothetical protein | - |
| CGQ03_RS02090 (CGQ03_00376) | - | 430089..431045 (-) | 957 | WP_000956137.1 | hypothetical protein | - |
| CGQ03_RS02095 (CGQ03_00377) | - | 431163..431825 (-) | 663 | WP_000394698.1 | hypothetical protein | - |
| CGQ03_RS02100 (CGQ03_00378) | - | 431968..432375 (-) | 408 | WP_000763767.1 | general stress protein | - |
| CGQ03_RS02105 (CGQ03_00379) | xpt | 432888..433466 (+) | 579 | WP_000421410.1 | xanthine phosphoribosyltransferase | - |
| CGQ03_RS02110 (CGQ03_00380) | pbuX | 433466..434734 (+) | 1269 | WP_000793023.1 | xanthine permease PbuX | - |
| CGQ03_RS02115 (CGQ03_00381) | guaB | 434772..436238 (+) | 1467 | WP_000264071.1 | IMP dehydrogenase | - |
| CGQ03_RS02120 (CGQ03_00382) | guaA | 436263..437804 (+) | 1542 | WP_000424963.1 | glutamine-hydrolyzing GMP synthase | - |
| CGQ03_RS02125 (CGQ03_00383) | - | 437917..438453 (-) | 537 | WP_000551643.1 | hypothetical protein | - |
| CGQ03_RS02130 (CGQ03_00384) | - | 438845..439549 (-) | 705 | WP_000041880.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| CGQ03_RS02135 (CGQ03_00385) | - | 439948..440220 (-) | 273 | WP_000159787.1 | transposase | - |
| CGQ03_RS02145 (CGQ03_00386) | - | 440481..440633 (-) | 153 | WP_000248844.1 | hypothetical protein | - |
| CGQ03_RS02150 (CGQ03_00387) | - | 441165..441524 (-) | 360 | WP_001021623.1 | DUF1304 domain-containing protein | - |
Sequence
Protein
Download Length: 167 a.a. Molecular weight: 18539.12 Da Isoelectric Point: 4.7305
>NTDB_id=243222 CGQ03_RS01860 WP_000934799.1 399199..399702(+) (ssbA) [Staphylococcus aureus strain 628]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDI
SDDDLPF
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDI
SDDDLPF
Nucleotide
Download Length: 504 bp
>NTDB_id=243222 CGQ03_RS01860 WP_000934799.1 399199..399702(+) (ssbA) [Staphylococcus aureus strain 628]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTCCTTGAACCTAAAAA
TGCGCAACAAAATGGTGGCCAACGTCAACAAAATGAATTCCAAGATTACGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAACAATTCGTACAATAATTCATCAAACACGAAACAATCTGATAATCCATTTGCAAATGCAAACGGACCGATTGATATA
AGTGATGATGACTTACCATTCTAA
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTCCTTGAACCTAAAAA
TGCGCAACAAAATGGTGGCCAACGTCAACAAAATGAATTCCAAGATTACGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAACAATTCGTACAATAATTCATCAAACACGAAACAATCTGATAATCCATTTGCAAATGCAAACGGACCGATTGATATA
AGTGATGATGACTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
65.341 |
100 |
0.689 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.971 |
100 |
0.563 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
63.473 |
0.371 |
| ssb | Glaesserella parasuis strain SC1401 |
34.463 |
100 |
0.365 |