Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   CGP89_RS01860 Genome accession   NZ_CP022893
Coordinates   399226..399729 (+) Length   167 a.a.
NCBI ID   WP_000934799.1    Uniprot ID   A0A7U7IE99
Organism   Staphylococcus aureus strain 61     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 395166..441551 399226..399729 within 0


Gene organization within MGE regions


Location: 395166..441551
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CGP89_RS01825 (CGP89_00330) - 395166..396011 (+) 846 WP_001557587.1 ParB/RepB/Spo0J family partition protein -
  CGP89_RS01830 (CGP89_00331) - 396165..397046 (+) 882 WP_000373073.1 mechanosensitive ion channel family protein -
  CGP89_RS01835 (CGP89_00332) - 397076..397279 (+) 204 WP_000157348.1 DUF951 domain-containing protein -
  CGP89_RS01840 (CGP89_00333) ychF 397291..398388 (+) 1098 WP_001218732.1 redox-regulated ATPase YchF -
  CGP89_RS01845 (CGP89_00334) - 398474..398665 (-) 192 WP_001052484.1 hypothetical protein -
  CGP89_RS01855 (CGP89_00335) rpsF 398909..399205 (+) 297 WP_001261460.1 30S ribosomal protein S6 -
  CGP89_RS01860 (CGP89_00336) ssbA 399226..399729 (+) 504 WP_000934799.1 single-stranded DNA-binding protein Machinery gene
  CGP89_RS01865 (CGP89_00337) rpsR 399781..400023 (+) 243 WP_000897044.1 30S ribosomal protein S18 -
  CGP89_RS01870 (CGP89_00338) - 400255..400974 (-) 720 WP_000400841.1 type II toxin-antitoxin system PemK/MazF family toxin -
  CGP89_RS01875 (CGP89_00339) - 401087..402301 (-) 1215 WP_000270135.1 site-specific integrase -
  CGP89_RS01880 (CGP89_00340) - 402462..403085 (-) 624 WP_000230361.1 helix-turn-helix transcriptional regulator -
  CGP89_RS01885 (CGP89_00341) - 403234..403398 (+) 165 WP_001611932.1 helix-turn-helix domain-containing protein -
  CGP89_RS01890 (CGP89_00342) - 403399..403671 (+) 273 WP_031870322.1 helix-turn-helix domain-containing protein -
  CGP89_RS01895 (CGP89_00343) - 403683..403856 (+) 174 WP_000784892.1 hypothetical protein -
  CGP89_RS01900 (CGP89_00344) - 403823..404026 (+) 204 WP_001231376.1 hypothetical protein -
  CGP89_RS01905 (CGP89_00345) - 404028..404411 (+) 384 WP_000403837.1 hypothetical protein -
  CGP89_RS01910 (CGP89_00346) - 404412..404738 (+) 327 WP_001103967.1 DUF1474 family protein -
  CGP89_RS01915 (CGP89_00347) - 404803..405672 (+) 870 WP_031870360.1 primase alpha helix C-terminal domain-containing protein -
  CGP89_RS01920 (CGP89_00348) - 405684..407054 (+) 1371 WP_000151864.1 DNA primase family protein -
  CGP89_RS01925 (CGP89_00349) - 407297..407653 (+) 357 WP_001059599.1 hypothetical protein -
  CGP89_RS01930 (CGP89_00350) - 407646..407918 (+) 273 WP_223297761.1 hypothetical protein -
  CGP89_RS01935 (CGP89_00351) - 407920..408561 (+) 642 WP_031870361.1 pathogenicity island protein -
  CGP89_RS01940 (CGP89_00352) - 409269..409613 (+) 345 WP_001288442.1 hypothetical protein -
  CGP89_RS01945 (CGP89_00353) - 409644..410297 (+) 654 WP_000214170.1 hypothetical protein -
  CGP89_RS01950 (CGP89_00354) - 410350..410877 (+) 528 WP_031870369.1 spore coat protein -
  CGP89_RS01955 - 411009..411221 (+) 213 WP_001656917.1 hypothetical protein -
  CGP89_RS01960 (CGP89_00356) - 411218..411787 (+) 570 WP_001293071.1 terminase small subunit -
  CGP89_RS15430 - 411834..411917 (+) 84 Protein_371 terminase small subunit -
  CGP89_RS01970 (CGP89_00357) - 412064..413032 (+) 969 WP_000801980.1 Abi family protein -
  CGP89_RS01975 (CGP89_00358) - 413174..413611 (+) 438 WP_073392942.1 DUF3102 domain-containing protein -
  CGP89_RS01980 (CGP89_00359) - 413729..414241 (+) 513 WP_000813311.1 hypothetical protein -
  CGP89_RS15435 - 414257..414436 (+) 180 WP_000797954.1 hypothetical protein -
  CGP89_RS01995 (CGP89_00360) - 414555..415727 (+) 1173 WP_000195429.1 IS256-like element IS256 family transposase -
  CGP89_RS02000 (CGP89_00361) - 416571..417509 (-) 939 WP_001817700.1 Abi family protein -
  CGP89_RS02005 - 417548..418261 (-) 714 Protein_378 tyrosine-type recombinase/integrase -
  CGP89_RS02010 (CGP89_00362) selX 418467..419078 (+) 612 WP_000475325.1 staphylococcal enterotoxin-like toxin X -
  CGP89_RS02015 (CGP89_00363) - 419447..419815 (+) 369 WP_000849163.1 YxeA family protein -
  CGP89_RS02020 (CGP89_00364) - 419996..420568 (+) 573 WP_000769722.1 PepSY domain-containing protein -
  CGP89_RS02025 (CGP89_00365) - 420705..420968 (-) 264 WP_001055897.1 helix-turn-helix transcriptional regulator -
  CGP89_RS02030 (CGP89_00366) - 421268..421519 (+) 252 WP_000466748.1 GlsB/YeaQ/YmgE family stress response membrane protein -
  CGP89_RS02035 - 421558..421767 (-) 210 WP_000211677.1 hypothetical protein -
  CGP89_RS02040 (CGP89_00367) - 421945..422526 (+) 582 WP_000158375.1 histidine phosphatase family protein -
  CGP89_RS02045 (CGP89_00368) - 422592..422975 (-) 384 WP_000868256.1 hypothetical protein -
  CGP89_RS02050 (CGP89_00370) - 423245..423871 (-) 627 WP_000746679.1 NDxxF motif lipoprotein -
  CGP89_RS02055 (CGP89_00371) - 423944..424162 (-) 219 Protein_388 hypothetical protein -
  CGP89_RS02060 (CGP89_00372) ahpF 424315..425838 (-) 1524 WP_000930514.1 alkyl hydroperoxide reductase subunit F -
  CGP89_RS02065 (CGP89_00373) ahpC 425854..426423 (-) 570 WP_000052781.1 alkyl hydroperoxide reductase subunit C -
  CGP89_RS02070 (CGP89_00374) nfsA 426915..427670 (+) 756 WP_001287099.1 oxygen-insensitive NADPH nitroreductase -
  CGP89_RS02075 (CGP89_00375) - 427750..429138 (-) 1389 WP_000991018.1 L-cystine transporter -
  CGP89_RS02080 - 429223..429321 (+) 99 WP_001792089.1 hypothetical protein -
  CGP89_RS02090 (CGP89_00376) - 430116..431072 (-) 957 WP_000956137.1 hypothetical protein -
  CGP89_RS02095 (CGP89_00377) - 431190..431852 (-) 663 WP_000394698.1 hypothetical protein -
  CGP89_RS02100 (CGP89_00378) - 431995..432402 (-) 408 WP_000763767.1 general stress protein -
  CGP89_RS02105 (CGP89_00379) xpt 432915..433493 (+) 579 WP_000421410.1 xanthine phosphoribosyltransferase -
  CGP89_RS02110 (CGP89_00380) pbuX 433493..434761 (+) 1269 WP_000793023.1 xanthine permease PbuX -
  CGP89_RS02115 (CGP89_00381) guaB 434799..436265 (+) 1467 WP_000264071.1 IMP dehydrogenase -
  CGP89_RS02120 (CGP89_00382) guaA 436290..437831 (+) 1542 WP_000424963.1 glutamine-hydrolyzing GMP synthase -
  CGP89_RS02125 (CGP89_00383) - 437944..438480 (-) 537 WP_000551643.1 hypothetical protein -
  CGP89_RS02130 (CGP89_00384) - 438872..439576 (-) 705 WP_000041880.1 type II toxin-antitoxin system PemK/MazF family toxin -
  CGP89_RS02135 (CGP89_00385) - 439975..440247 (-) 273 WP_000159787.1 transposase -
  CGP89_RS02145 (CGP89_00386) - 440508..440660 (-) 153 WP_000248844.1 hypothetical protein -
  CGP89_RS02150 (CGP89_00387) - 441192..441551 (-) 360 WP_001021623.1 DUF1304 domain-containing protein -

Sequence


Protein


Download         Length: 167 a.a.        Molecular weight: 18539.12 Da        Isoelectric Point: 4.7305

>NTDB_id=242721 CGP89_RS01860 WP_000934799.1 399226..399729(+) (ssbA) [Staphylococcus aureus strain 61]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDI
SDDDLPF

Nucleotide


Download         Length: 504 bp        

>NTDB_id=242721 CGP89_RS01860 WP_000934799.1 399226..399729(+) (ssbA) [Staphylococcus aureus strain 61]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTCCTTGAACCTAAAAA
TGCGCAACAAAATGGTGGCCAACGTCAACAAAATGAATTCCAAGATTACGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAACAATTCGTACAATAATTCATCAAACACGAAACAATCTGATAATCCATTTGCAAATGCAAACGGACCGATTGATATA
AGTGATGATGACTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A7U7IE99

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

65.341

100

0.689

  ssb Latilactobacillus sakei subsp. sakei 23K

54.971

100

0.563

  ssbB Bacillus subtilis subsp. subtilis str. 168

58.491

63.473

0.371

  ssb Glaesserella parasuis strain SC1401

34.463

100

0.365


Multiple sequence alignment