Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | CGP89_RS01860 | Genome accession | NZ_CP022893 |
| Coordinates | 399226..399729 (+) | Length | 167 a.a. |
| NCBI ID | WP_000934799.1 | Uniprot ID | A0A7U7IE99 |
| Organism | Staphylococcus aureus strain 61 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 395166..441551 | 399226..399729 | within | 0 |
Gene organization within MGE regions
Location: 395166..441551
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CGP89_RS01825 (CGP89_00330) | - | 395166..396011 (+) | 846 | WP_001557587.1 | ParB/RepB/Spo0J family partition protein | - |
| CGP89_RS01830 (CGP89_00331) | - | 396165..397046 (+) | 882 | WP_000373073.1 | mechanosensitive ion channel family protein | - |
| CGP89_RS01835 (CGP89_00332) | - | 397076..397279 (+) | 204 | WP_000157348.1 | DUF951 domain-containing protein | - |
| CGP89_RS01840 (CGP89_00333) | ychF | 397291..398388 (+) | 1098 | WP_001218732.1 | redox-regulated ATPase YchF | - |
| CGP89_RS01845 (CGP89_00334) | - | 398474..398665 (-) | 192 | WP_001052484.1 | hypothetical protein | - |
| CGP89_RS01855 (CGP89_00335) | rpsF | 398909..399205 (+) | 297 | WP_001261460.1 | 30S ribosomal protein S6 | - |
| CGP89_RS01860 (CGP89_00336) | ssbA | 399226..399729 (+) | 504 | WP_000934799.1 | single-stranded DNA-binding protein | Machinery gene |
| CGP89_RS01865 (CGP89_00337) | rpsR | 399781..400023 (+) | 243 | WP_000897044.1 | 30S ribosomal protein S18 | - |
| CGP89_RS01870 (CGP89_00338) | - | 400255..400974 (-) | 720 | WP_000400841.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| CGP89_RS01875 (CGP89_00339) | - | 401087..402301 (-) | 1215 | WP_000270135.1 | site-specific integrase | - |
| CGP89_RS01880 (CGP89_00340) | - | 402462..403085 (-) | 624 | WP_000230361.1 | helix-turn-helix transcriptional regulator | - |
| CGP89_RS01885 (CGP89_00341) | - | 403234..403398 (+) | 165 | WP_001611932.1 | helix-turn-helix domain-containing protein | - |
| CGP89_RS01890 (CGP89_00342) | - | 403399..403671 (+) | 273 | WP_031870322.1 | helix-turn-helix domain-containing protein | - |
| CGP89_RS01895 (CGP89_00343) | - | 403683..403856 (+) | 174 | WP_000784892.1 | hypothetical protein | - |
| CGP89_RS01900 (CGP89_00344) | - | 403823..404026 (+) | 204 | WP_001231376.1 | hypothetical protein | - |
| CGP89_RS01905 (CGP89_00345) | - | 404028..404411 (+) | 384 | WP_000403837.1 | hypothetical protein | - |
| CGP89_RS01910 (CGP89_00346) | - | 404412..404738 (+) | 327 | WP_001103967.1 | DUF1474 family protein | - |
| CGP89_RS01915 (CGP89_00347) | - | 404803..405672 (+) | 870 | WP_031870360.1 | primase alpha helix C-terminal domain-containing protein | - |
| CGP89_RS01920 (CGP89_00348) | - | 405684..407054 (+) | 1371 | WP_000151864.1 | DNA primase family protein | - |
| CGP89_RS01925 (CGP89_00349) | - | 407297..407653 (+) | 357 | WP_001059599.1 | hypothetical protein | - |
| CGP89_RS01930 (CGP89_00350) | - | 407646..407918 (+) | 273 | WP_223297761.1 | hypothetical protein | - |
| CGP89_RS01935 (CGP89_00351) | - | 407920..408561 (+) | 642 | WP_031870361.1 | pathogenicity island protein | - |
| CGP89_RS01940 (CGP89_00352) | - | 409269..409613 (+) | 345 | WP_001288442.1 | hypothetical protein | - |
| CGP89_RS01945 (CGP89_00353) | - | 409644..410297 (+) | 654 | WP_000214170.1 | hypothetical protein | - |
| CGP89_RS01950 (CGP89_00354) | - | 410350..410877 (+) | 528 | WP_031870369.1 | spore coat protein | - |
| CGP89_RS01955 | - | 411009..411221 (+) | 213 | WP_001656917.1 | hypothetical protein | - |
| CGP89_RS01960 (CGP89_00356) | - | 411218..411787 (+) | 570 | WP_001293071.1 | terminase small subunit | - |
| CGP89_RS15430 | - | 411834..411917 (+) | 84 | Protein_371 | terminase small subunit | - |
| CGP89_RS01970 (CGP89_00357) | - | 412064..413032 (+) | 969 | WP_000801980.1 | Abi family protein | - |
| CGP89_RS01975 (CGP89_00358) | - | 413174..413611 (+) | 438 | WP_073392942.1 | DUF3102 domain-containing protein | - |
| CGP89_RS01980 (CGP89_00359) | - | 413729..414241 (+) | 513 | WP_000813311.1 | hypothetical protein | - |
| CGP89_RS15435 | - | 414257..414436 (+) | 180 | WP_000797954.1 | hypothetical protein | - |
| CGP89_RS01995 (CGP89_00360) | - | 414555..415727 (+) | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
| CGP89_RS02000 (CGP89_00361) | - | 416571..417509 (-) | 939 | WP_001817700.1 | Abi family protein | - |
| CGP89_RS02005 | - | 417548..418261 (-) | 714 | Protein_378 | tyrosine-type recombinase/integrase | - |
| CGP89_RS02010 (CGP89_00362) | selX | 418467..419078 (+) | 612 | WP_000475325.1 | staphylococcal enterotoxin-like toxin X | - |
| CGP89_RS02015 (CGP89_00363) | - | 419447..419815 (+) | 369 | WP_000849163.1 | YxeA family protein | - |
| CGP89_RS02020 (CGP89_00364) | - | 419996..420568 (+) | 573 | WP_000769722.1 | PepSY domain-containing protein | - |
| CGP89_RS02025 (CGP89_00365) | - | 420705..420968 (-) | 264 | WP_001055897.1 | helix-turn-helix transcriptional regulator | - |
| CGP89_RS02030 (CGP89_00366) | - | 421268..421519 (+) | 252 | WP_000466748.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
| CGP89_RS02035 | - | 421558..421767 (-) | 210 | WP_000211677.1 | hypothetical protein | - |
| CGP89_RS02040 (CGP89_00367) | - | 421945..422526 (+) | 582 | WP_000158375.1 | histidine phosphatase family protein | - |
| CGP89_RS02045 (CGP89_00368) | - | 422592..422975 (-) | 384 | WP_000868256.1 | hypothetical protein | - |
| CGP89_RS02050 (CGP89_00370) | - | 423245..423871 (-) | 627 | WP_000746679.1 | NDxxF motif lipoprotein | - |
| CGP89_RS02055 (CGP89_00371) | - | 423944..424162 (-) | 219 | Protein_388 | hypothetical protein | - |
| CGP89_RS02060 (CGP89_00372) | ahpF | 424315..425838 (-) | 1524 | WP_000930514.1 | alkyl hydroperoxide reductase subunit F | - |
| CGP89_RS02065 (CGP89_00373) | ahpC | 425854..426423 (-) | 570 | WP_000052781.1 | alkyl hydroperoxide reductase subunit C | - |
| CGP89_RS02070 (CGP89_00374) | nfsA | 426915..427670 (+) | 756 | WP_001287099.1 | oxygen-insensitive NADPH nitroreductase | - |
| CGP89_RS02075 (CGP89_00375) | - | 427750..429138 (-) | 1389 | WP_000991018.1 | L-cystine transporter | - |
| CGP89_RS02080 | - | 429223..429321 (+) | 99 | WP_001792089.1 | hypothetical protein | - |
| CGP89_RS02090 (CGP89_00376) | - | 430116..431072 (-) | 957 | WP_000956137.1 | hypothetical protein | - |
| CGP89_RS02095 (CGP89_00377) | - | 431190..431852 (-) | 663 | WP_000394698.1 | hypothetical protein | - |
| CGP89_RS02100 (CGP89_00378) | - | 431995..432402 (-) | 408 | WP_000763767.1 | general stress protein | - |
| CGP89_RS02105 (CGP89_00379) | xpt | 432915..433493 (+) | 579 | WP_000421410.1 | xanthine phosphoribosyltransferase | - |
| CGP89_RS02110 (CGP89_00380) | pbuX | 433493..434761 (+) | 1269 | WP_000793023.1 | xanthine permease PbuX | - |
| CGP89_RS02115 (CGP89_00381) | guaB | 434799..436265 (+) | 1467 | WP_000264071.1 | IMP dehydrogenase | - |
| CGP89_RS02120 (CGP89_00382) | guaA | 436290..437831 (+) | 1542 | WP_000424963.1 | glutamine-hydrolyzing GMP synthase | - |
| CGP89_RS02125 (CGP89_00383) | - | 437944..438480 (-) | 537 | WP_000551643.1 | hypothetical protein | - |
| CGP89_RS02130 (CGP89_00384) | - | 438872..439576 (-) | 705 | WP_000041880.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| CGP89_RS02135 (CGP89_00385) | - | 439975..440247 (-) | 273 | WP_000159787.1 | transposase | - |
| CGP89_RS02145 (CGP89_00386) | - | 440508..440660 (-) | 153 | WP_000248844.1 | hypothetical protein | - |
| CGP89_RS02150 (CGP89_00387) | - | 441192..441551 (-) | 360 | WP_001021623.1 | DUF1304 domain-containing protein | - |
Sequence
Protein
Download Length: 167 a.a. Molecular weight: 18539.12 Da Isoelectric Point: 4.7305
>NTDB_id=242721 CGP89_RS01860 WP_000934799.1 399226..399729(+) (ssbA) [Staphylococcus aureus strain 61]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDI
SDDDLPF
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDI
SDDDLPF
Nucleotide
Download Length: 504 bp
>NTDB_id=242721 CGP89_RS01860 WP_000934799.1 399226..399729(+) (ssbA) [Staphylococcus aureus strain 61]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTCCTTGAACCTAAAAA
TGCGCAACAAAATGGTGGCCAACGTCAACAAAATGAATTCCAAGATTACGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAACAATTCGTACAATAATTCATCAAACACGAAACAATCTGATAATCCATTTGCAAATGCAAACGGACCGATTGATATA
AGTGATGATGACTTACCATTCTAA
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTCCTTGAACCTAAAAA
TGCGCAACAAAATGGTGGCCAACGTCAACAAAATGAATTCCAAGATTACGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAACAATTCGTACAATAATTCATCAAACACGAAACAATCTGATAATCCATTTGCAAATGCAAACGGACCGATTGATATA
AGTGATGATGACTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
65.341 |
100 |
0.689 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.971 |
100 |
0.563 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
63.473 |
0.371 |
| ssb | Glaesserella parasuis strain SC1401 |
34.463 |
100 |
0.365 |