Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | FORC62_RS01910 | Genome accession | NZ_CP022582 |
| Coordinates | 406424..406927 (+) | Length | 167 a.a. |
| NCBI ID | WP_000934799.1 | Uniprot ID | A0A7U7IE99 |
| Organism | Staphylococcus aureus strain FORC_062 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 402267..450734 | 406424..406927 | within | 0 |
Gene organization within MGE regions
Location: 402267..450734
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FORC62_RS01875 (FORC62_0353) | - | 402364..403209 (+) | 846 | WP_001557587.1 | ParB/RepB/Spo0J family partition protein | - |
| FORC62_RS01880 (FORC62_0354) | - | 403363..404244 (+) | 882 | WP_114914750.1 | mechanosensitive ion channel family protein | - |
| FORC62_RS01885 (FORC62_0355) | - | 404274..404477 (+) | 204 | WP_000157348.1 | DUF951 domain-containing protein | - |
| FORC62_RS01890 (FORC62_0356) | ychF | 404489..405586 (+) | 1098 | WP_001218732.1 | redox-regulated ATPase YchF | - |
| FORC62_RS01895 (FORC62_0357) | - | 405672..405863 (-) | 192 | WP_001052484.1 | hypothetical protein | - |
| FORC62_RS01905 (FORC62_0358) | rpsF | 406107..406403 (+) | 297 | WP_001261460.1 | 30S ribosomal protein S6 | - |
| FORC62_RS01910 (FORC62_0359) | ssbA | 406424..406927 (+) | 504 | WP_000934799.1 | single-stranded DNA-binding protein | Machinery gene |
| FORC62_RS01915 (FORC62_0360) | rpsR | 406979..407221 (+) | 243 | WP_000897044.1 | 30S ribosomal protein S18 | - |
| FORC62_RS01920 (FORC62_0361) | - | 407498..408436 (-) | 939 | WP_001817700.1 | Abi family protein | - |
| FORC62_RS01925 | - | 408475..409188 (-) | 714 | Protein_363 | tyrosine-type recombinase/integrase | - |
| FORC62_RS01930 (FORC62_0363) | selX | 409394..410005 (+) | 612 | WP_000475325.1 | staphylococcal enterotoxin-like toxin X | - |
| FORC62_RS01935 (FORC62_0364) | - | 410374..410742 (+) | 369 | WP_000849163.1 | YxeA family protein | - |
| FORC62_RS01940 (FORC62_0365) | - | 410923..411495 (+) | 573 | WP_000769722.1 | PepSY domain-containing protein | - |
| FORC62_RS01945 (FORC62_0366) | - | 411632..411895 (-) | 264 | WP_001055897.1 | helix-turn-helix transcriptional regulator | - |
| FORC62_RS01950 (FORC62_0367) | - | 412195..412446 (+) | 252 | WP_000466748.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
| FORC62_RS01955 (FORC62_0368) | - | 412485..412694 (-) | 210 | WP_000211677.1 | hypothetical protein | - |
| FORC62_RS01960 (FORC62_0369) | - | 412872..413453 (+) | 582 | WP_000158375.1 | histidine phosphatase family protein | - |
| FORC62_RS01965 (FORC62_0370) | - | 413519..413902 (-) | 384 | WP_000868259.1 | hypothetical protein | - |
| FORC62_RS01970 (FORC62_0371) | - | 414172..414798 (-) | 627 | WP_000746679.1 | NDxxF motif lipoprotein | - |
| FORC62_RS01975 (FORC62_0372) | - | 414871..415089 (-) | 219 | Protein_373 | hypothetical protein | - |
| FORC62_RS01980 (FORC62_0373) | ahpF | 415242..416765 (-) | 1524 | WP_000930514.1 | alkyl hydroperoxide reductase subunit F | - |
| FORC62_RS01985 (FORC62_0374) | ahpC | 416781..417350 (-) | 570 | WP_000052781.1 | alkyl hydroperoxide reductase subunit C | - |
| FORC62_RS01990 (FORC62_0375) | nfsA | 417842..418597 (+) | 756 | WP_114914751.1 | oxygen-insensitive NADPH nitroreductase | - |
| FORC62_RS01995 (FORC62_0376) | - | 418677..420065 (-) | 1389 | WP_000991018.1 | L-cystine transporter | - |
| FORC62_RS02000 | - | 420150..420248 (+) | 99 | WP_001792089.1 | hypothetical protein | - |
| FORC62_RS02010 (FORC62_0377) | - | 420912..422231 (+) | 1320 | WP_001557163.1 | ISL3-like element IS1181 family transposase | - |
| FORC62_RS15325 | - | 422234..422311 (+) | 78 | Protein_380 | hypothetical protein | - |
| FORC62_RS02015 (FORC62_0378) | - | 422563..423519 (-) | 957 | WP_000956137.1 | hypothetical protein | - |
| FORC62_RS02020 (FORC62_0379) | - | 423637..424299 (-) | 663 | WP_000394698.1 | hypothetical protein | - |
| FORC62_RS02025 (FORC62_0380) | - | 424442..424849 (-) | 408 | WP_000763767.1 | general stress protein | - |
| FORC62_RS02030 (FORC62_0381) | xpt | 425362..425940 (+) | 579 | WP_000421410.1 | xanthine phosphoribosyltransferase | - |
| FORC62_RS02035 (FORC62_0382) | pbuX | 425940..427208 (+) | 1269 | WP_000793018.1 | xanthine permease PbuX | - |
| FORC62_RS02040 (FORC62_0383) | guaB | 427246..428712 (+) | 1467 | WP_000264071.1 | IMP dehydrogenase | - |
| FORC62_RS02045 (FORC62_0384) | guaA | 428737..430278 (+) | 1542 | WP_000424963.1 | glutamine-hydrolyzing GMP synthase | - |
| FORC62_RS02050 (FORC62_0385) | - | 430346..431539 (-) | 1194 | WP_000237797.1 | site-specific integrase | - |
| FORC62_RS02055 (FORC62_0386) | - | 431566..431766 (-) | 201 | WP_000633907.1 | DUF3173 family protein | - |
| FORC62_RS02065 (FORC62_0387) | - | 432264..432494 (-) | 231 | WP_000845143.1 | helix-turn-helix domain-containing protein | - |
| FORC62_RS02070 (FORC62_0388) | - | 432491..432913 (-) | 423 | WP_000804879.1 | sigma-70 family RNA polymerase sigma factor | - |
| FORC62_RS02080 (FORC62_0389) | - | 433444..433797 (+) | 354 | WP_001227350.1 | helix-turn-helix domain-containing protein | - |
| FORC62_RS02085 | - | 433855..434043 (-) | 189 | WP_032506803.1 | cysteine-rich KTR domain-containing protein | - |
| FORC62_RS02090 (FORC62_0390) | tet(M) | 434141..436060 (-) | 1920 | WP_000691737.1 | tetracycline resistance ribosomal protection protein Tet(M) | - |
| FORC62_RS02095 | - | 436076..436192 (-) | 117 | WP_001791010.1 | tetracycline resistance determinant leader peptide | - |
| FORC62_RS02105 (FORC62_0391) | - | 436437..437366 (-) | 930 | WP_000584387.1 | conjugal transfer protein | - |
| FORC62_RS02110 (FORC62_0392) | - | 437383..438405 (-) | 1023 | WP_000768373.1 | bifunctional lytic transglycosylase/C40 family peptidase | - |
| FORC62_RS02115 (FORC62_0393) | - | 438402..440429 (-) | 2028 | WP_000192393.1 | CD3337/EF1877 family mobilome membrane protein | - |
| FORC62_RS02120 (FORC62_0394) | - | 440426..442879 (-) | 2454 | WP_000331165.1 | ATP-binding protein | - |
| FORC62_RS02125 (FORC62_0395) | - | 442863..443258 (-) | 396 | WP_000723887.1 | conjugal transfer protein | - |
| FORC62_RS02130 (FORC62_0396) | - | 443330..443968 (-) | 639 | WP_000248477.1 | DUF6037 family protein | - |
| FORC62_RS02135 (FORC62_0397) | - | 444024..444524 (-) | 501 | WP_000425404.1 | antirestriction protein ArdA | - |
| FORC62_RS02140 (FORC62_0398) | - | 444585..445364 (-) | 780 | WP_000675717.1 | abortive infection family protein | - |
| FORC62_RS02145 (FORC62_0399) | - | 445406..445627 (-) | 222 | WP_001009054.1 | hypothetical protein | - |
| FORC62_RS02150 (FORC62_0400) | - | 445624..445914 (-) | 291 | WP_000055376.1 | hypothetical protein | - |
| FORC62_RS02155 (FORC62_0401) | mobT | 445911..447095 (-) | 1185 | WP_000426689.1 | MobT family relaxase | - |
| FORC62_RS02160 (FORC62_0402) | - | 447277..448680 (-) | 1404 | WP_001130244.1 | FtsK/SpoIIIE domain-containing protein | - |
| FORC62_RS02165 (FORC62_0403) | - | 448702..449475 (-) | 774 | WP_000185761.1 | hypothetical protein | - |
| FORC62_RS02170 (FORC62_0404) | - | 449485..449862 (-) | 378 | WP_001234191.1 | YdcP family protein | - |
| FORC62_RS02175 (FORC62_0405) | - | 449883..450197 (-) | 315 | WP_000421279.1 | YdcP family protein | - |
Sequence
Protein
Download Length: 167 a.a. Molecular weight: 18539.12 Da Isoelectric Point: 4.7305
>NTDB_id=240970 FORC62_RS01910 WP_000934799.1 406424..406927(+) (ssbA) [Staphylococcus aureus strain FORC_062]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDI
SDDDLPF
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDI
SDDDLPF
Nucleotide
Download Length: 504 bp
>NTDB_id=240970 FORC62_RS01910 WP_000934799.1 406424..406927(+) (ssbA) [Staphylococcus aureus strain FORC_062]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTCCTTGAACCTAAAAA
TGCGCAACAAAATGGTGGCCAACGTCAACAAAATGAATTCCAAGATTACGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAACAATTCGTACAATAATTCATCAAACACGAAACAATCTGATAATCCATTTGCAAATGCAAACGGACCGATTGATATA
AGTGATGATGACTTACCATTCTAA
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTCCTTGAACCTAAAAA
TGCGCAACAAAATGGTGGCCAACGTCAACAAAATGAATTCCAAGATTACGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAACAATTCGTACAATAATTCATCAAACACGAAACAATCTGATAATCCATTTGCAAATGCAAACGGACCGATTGATATA
AGTGATGATGACTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
65.341 |
100 |
0.689 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.971 |
100 |
0.563 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
63.473 |
0.371 |
| ssb | Glaesserella parasuis strain SC1401 |
34.463 |
100 |
0.365 |