Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   C7M29_RS13435 Genome accession   NZ_CP028217
Coordinates   2583643..2584026 (+) Length   127 a.a.
NCBI ID   WP_032726158.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM102751     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2578643..2589026
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M29_RS13400 (C7M29_02629) corA 2579096..2580049 (+) 954 WP_004399136.1 magnesium transporter CorA -
  C7M29_RS13405 (C7M29_02630) - 2580051..2580248 (+) 198 WP_161476868.1 CBS domain-containing protein -
  C7M29_RS13410 (C7M29_02632) comGA 2580461..2581531 (+) 1071 WP_161476869.1 competence protein ComGA Machinery gene
  C7M29_RS13415 (C7M29_02633) comGB 2581518..2582555 (+) 1038 WP_080529539.1 comG operon protein ComGB Machinery gene
  C7M29_RS13420 (C7M29_02634) comGC 2582569..2582865 (+) 297 WP_014114400.1 comG operon protein ComGC Machinery gene
  C7M29_RS13425 (C7M29_02635) comGD 2582855..2583286 (+) 432 WP_015714255.1 comG operon protein ComGD Machinery gene
  C7M29_RS13430 (C7M29_02636) comGE 2583270..2583617 (+) 348 WP_033884703.1 ComG operon protein 5 Machinery gene
  C7M29_RS13435 comGF 2583643..2584026 (+) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  C7M29_RS13440 (C7M29_02638) comGG 2584027..2584401 (+) 375 WP_033884701.1 ComG operon protein ComGG Machinery gene
  C7M29_RS13445 (C7M29_02639) spoIITA 2584473..2584652 (+) 180 WP_014480252.1 YqzE family protein -
  C7M29_RS13450 (C7M29_02640) yqzG 2584694..2585020 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  C7M29_RS13455 (C7M29_02641) tapA 2585292..2586053 (+) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  C7M29_RS13460 (C7M29_02642) sipW 2586037..2586609 (+) 573 WP_106073729.1 signal peptidase I SipW -
  C7M29_RS13465 (C7M29_02643) tasA 2586673..2587458 (+) 786 WP_161476870.1 biofilm matrix protein TasA -
  C7M29_RS13470 (C7M29_02644) sinR 2587551..2587886 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C7M29_RS13475 (C7M29_02645) sinI 2587920..2588093 (-) 174 WP_003230187.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14315.39 Da        Isoelectric Point: 5.8929

>NTDB_id=240380 C7M29_RS13435 WP_032726158.1 2583643..2584026(+) (comGF) [Bacillus subtilis strain SRCM102751]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=240380 C7M29_RS13435 WP_032726158.1 2583643..2584026(+) (comGF) [Bacillus subtilis strain SRCM102751]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTATCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992