Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   S101392_RS12865 Genome accession   NZ_CP021921
Coordinates   2506711..2507094 (-) Length   127 a.a.
NCBI ID   WP_029317913.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain SRCM101392     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2501711..2512094
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S101392_RS12825 (S101392_02552) sinI 2502645..2502818 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  S101392_RS12830 (S101392_02553) sinR 2502852..2503187 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  S101392_RS12835 (S101392_02554) tasA 2503280..2504065 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  S101392_RS12840 (S101392_02555) sipW 2504129..2504701 (-) 573 WP_080030740.1 signal peptidase I SipW -
  S101392_RS12845 (S101392_02556) tapA 2504685..2505446 (-) 762 WP_088326478.1 amyloid fiber anchoring/assembly protein TapA -
  S101392_RS12850 (S101392_02557) yqzG 2505718..2506044 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  S101392_RS12855 (S101392_02558) spoIITA 2506086..2506265 (-) 180 WP_072175549.1 YqzE family protein -
  S101392_RS12860 (S101392_02559) comGG 2506336..2506710 (-) 375 WP_029317914.1 ComG operon protein ComGG Machinery gene
  S101392_RS12865 comGF 2506711..2507094 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  S101392_RS12870 (S101392_02561) comGE 2507120..2507467 (-) 348 WP_015714254.1 ComG operon protein 5 Machinery gene
  S101392_RS12875 (S101392_02562) comGD 2507451..2507882 (-) 432 WP_015714255.1 comG operon protein ComGD Machinery gene
  S101392_RS12880 (S101392_02563) comGC 2507872..2508168 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  S101392_RS12885 (S101392_02564) comGB 2508182..2509219 (-) 1038 WP_015714257.1 comG operon protein ComGB Machinery gene
  S101392_RS12890 (S101392_02565) comGA 2509206..2510276 (-) 1071 WP_015714258.1 competence protein ComGA Machinery gene
  S101392_RS12900 (S101392_02568) corA 2510688..2511641 (-) 954 WP_088326481.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14363.43 Da        Isoelectric Point: 5.8949

>NTDB_id=234967 S101392_RS12865 WP_029317913.1 2506711..2507094(-) (comGF) [Bacillus subtilis subsp. subtilis strain SRCM101392]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=234967 S101392_RS12865 WP_029317913.1 2506711..2507094(-) (comGF) [Bacillus subtilis subsp. subtilis strain SRCM101392]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCAATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976


Multiple sequence alignment