Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   S101392_RS12825 Genome accession   NZ_CP021921
Coordinates   2502645..2502818 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis strain SRCM101392     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2497645..2507818
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S101392_RS12810 (S101392_02549) gcvT 2498445..2499533 (-) 1089 WP_088326475.1 glycine cleavage system aminomethyltransferase GcvT -
  S101392_RS12815 (S101392_02550) hepAA 2499974..2501647 (+) 1674 WP_041850014.1 SNF2-related protein -
  S101392_RS12820 (S101392_02551) yqhG 2501668..2502462 (+) 795 WP_003230200.1 YqhG family protein -
  S101392_RS12825 (S101392_02552) sinI 2502645..2502818 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  S101392_RS12830 (S101392_02553) sinR 2502852..2503187 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  S101392_RS12835 (S101392_02554) tasA 2503280..2504065 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  S101392_RS12840 (S101392_02555) sipW 2504129..2504701 (-) 573 WP_080030740.1 signal peptidase I SipW -
  S101392_RS12845 (S101392_02556) tapA 2504685..2505446 (-) 762 WP_088326478.1 amyloid fiber anchoring/assembly protein TapA -
  S101392_RS12850 (S101392_02557) yqzG 2505718..2506044 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  S101392_RS12855 (S101392_02558) spoIITA 2506086..2506265 (-) 180 WP_072175549.1 YqzE family protein -
  S101392_RS12860 (S101392_02559) comGG 2506336..2506710 (-) 375 WP_029317914.1 ComG operon protein ComGG Machinery gene
  S101392_RS12865 comGF 2506711..2507094 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  S101392_RS12870 (S101392_02561) comGE 2507120..2507467 (-) 348 WP_015714254.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=234964 S101392_RS12825 WP_003230187.1 2502645..2502818(+) (sinI) [Bacillus subtilis subsp. subtilis strain SRCM101392]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=234964 S101392_RS12825 WP_003230187.1 2502645..2502818(+) (sinI) [Bacillus subtilis subsp. subtilis strain SRCM101392]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment