Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   S100333_RS12970 Genome accession   NZ_CP021892
Coordinates   2420339..2420713 (-) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis subsp. subtilis strain SRCM100333     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2415339..2425713
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S100333_RS12930 (S100333_02645) yqhG 2415671..2416465 (+) 795 WP_014480249.1 YqhG family protein -
  S100333_RS12935 (S100333_02646) sinI 2416648..2416821 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  S100333_RS12940 (S100333_02647) sinR 2416855..2417190 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  S100333_RS12945 (S100333_02648) tasA 2417283..2418068 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  S100333_RS12950 (S100333_02649) sipW 2418132..2418704 (-) 573 WP_003230181.1 signal peptidase I SipW -
  S100333_RS12955 (S100333_02650) tapA 2418688..2419449 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  S100333_RS12960 (S100333_02651) yqzG 2419721..2420047 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  S100333_RS12965 (S100333_02652) spoIITA 2420089..2420268 (-) 180 WP_014480252.1 YqzE family protein -
  S100333_RS12970 (S100333_02653) comGG 2420339..2420713 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  S100333_RS12975 (S100333_02654) comGF 2420714..2421097 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  S100333_RS12980 (S100333_02655) comGE 2421123..2421470 (-) 348 WP_088272394.1 ComG operon protein 5 Machinery gene
  S100333_RS12985 (S100333_02656) comGD 2421454..2421885 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  S100333_RS12990 (S100333_02657) comGC 2421875..2422171 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  S100333_RS12995 (S100333_02658) comGB 2422185..2423222 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  S100333_RS13000 (S100333_02659) comGA 2423209..2424279 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  S100333_RS13005 (S100333_02660) - 2424491..2424688 (-) 198 WP_014480259.1 CBS domain-containing protein -
  S100333_RS13010 (S100333_02661) corA 2424690..2425643 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=234535 S100333_RS12970 WP_014480253.1 2420339..2420713(-) (comGG) [Bacillus subtilis subsp. subtilis strain SRCM100333]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=234535 S100333_RS12970 WP_014480253.1 2420339..2420713(-) (comGG) [Bacillus subtilis subsp. subtilis strain SRCM100333]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976

Multiple sequence alignment