Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | S100333_RS12935 | Genome accession | NZ_CP021892 |
| Coordinates | 2416648..2416821 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis strain SRCM100333 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2411648..2421821
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| S100333_RS12920 (S100333_02643) | gcvT | 2412447..2413535 (-) | 1089 | WP_014480247.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| S100333_RS12925 (S100333_02644) | hepAA | 2413977..2415650 (+) | 1674 | WP_014480248.1 | SNF2-related protein | - |
| S100333_RS12930 (S100333_02645) | yqhG | 2415671..2416465 (+) | 795 | WP_014480249.1 | YqhG family protein | - |
| S100333_RS12935 (S100333_02646) | sinI | 2416648..2416821 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| S100333_RS12940 (S100333_02647) | sinR | 2416855..2417190 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| S100333_RS12945 (S100333_02648) | tasA | 2417283..2418068 (-) | 786 | WP_014480250.1 | biofilm matrix protein TasA | - |
| S100333_RS12950 (S100333_02649) | sipW | 2418132..2418704 (-) | 573 | WP_003230181.1 | signal peptidase I SipW | - |
| S100333_RS12955 (S100333_02650) | tapA | 2418688..2419449 (-) | 762 | WP_014480251.1 | amyloid fiber anchoring/assembly protein TapA | - |
| S100333_RS12960 (S100333_02651) | yqzG | 2419721..2420047 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| S100333_RS12965 (S100333_02652) | spoIITA | 2420089..2420268 (-) | 180 | WP_014480252.1 | YqzE family protein | - |
| S100333_RS12970 (S100333_02653) | comGG | 2420339..2420713 (-) | 375 | WP_014480253.1 | ComG operon protein ComGG | Machinery gene |
| S100333_RS12975 (S100333_02654) | comGF | 2420714..2421097 (-) | 384 | WP_014480254.1 | ComG operon protein ComGF | Machinery gene |
| S100333_RS12980 (S100333_02655) | comGE | 2421123..2421470 (-) | 348 | WP_088272394.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=234533 S100333_RS12935 WP_003230187.1 2416648..2416821(+) (sinI) [Bacillus subtilis subsp. subtilis strain SRCM100333]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=234533 S100333_RS12935 WP_003230187.1 2416648..2416821(+) (sinI) [Bacillus subtilis subsp. subtilis strain SRCM100333]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |