Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   S101359_RS12575 Genome accession   NZ_CP021500
Coordinates   2560484..2560831 (-) Length   115 a.a.
NCBI ID   WP_088117570.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain SRCM101359     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2555484..2565831
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S101359_RS12530 (S101359_02473) sinI 2555983..2556156 (+) 174 WP_003325442.1 anti-repressor SinI family protein Regulator
  S101359_RS12535 (S101359_02474) sinR 2556190..2556525 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  S101359_RS12540 (S101359_02475) - 2556716..2557498 (-) 783 WP_063638541.1 TasA family protein -
  S101359_RS12545 (S101359_02476) - 2557562..2558134 (-) 573 WP_010789195.1 signal peptidase I -
  S101359_RS12550 (S101359_02477) tapA 2558118..2558819 (-) 702 WP_088117567.1 amyloid fiber anchoring/assembly protein TapA -
  S101359_RS12555 (S101359_02478) - 2559081..2559404 (+) 324 WP_088117568.1 DUF3889 domain-containing protein -
  S101359_RS12560 (S101359_02479) - 2559451..2559630 (-) 180 WP_003325435.1 YqzE family protein -
  S101359_RS12565 (S101359_02480) comGG 2559700..2560074 (-) 375 WP_088117569.1 competence type IV pilus minor pilin ComGG Machinery gene
  S101359_RS12570 (S101359_02481) comGF 2560075..2560581 (-) 507 WP_274379311.1 competence type IV pilus minor pilin ComGF -
  S101359_RS12575 (S101359_02482) comGE 2560484..2560831 (-) 348 WP_088117570.1 competence type IV pilus minor pilin ComGE Machinery gene
  S101359_RS12580 (S101359_02483) comGD 2560815..2561180 (-) 366 WP_258235513.1 competence type IV pilus minor pilin ComGD Machinery gene
  S101359_RS12585 (S101359_02484) comGC 2561245..2561553 (-) 309 WP_087941811.1 competence type IV pilus major pilin ComGC Machinery gene
  S101359_RS12590 (S101359_02485) comGB 2561559..2562596 (-) 1038 WP_088117572.1 competence type IV pilus assembly protein ComGB Machinery gene
  S101359_RS12595 (S101359_02486) comGA 2562583..2563653 (-) 1071 WP_088117573.1 competence type IV pilus ATPase ComGA Machinery gene
  S101359_RS12605 (S101359_02488) - 2564033..2564986 (-) 954 WP_088117575.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 115 a.a.        Molecular weight: 13326.25 Da        Isoelectric Point: 4.5702

>NTDB_id=231297 S101359_RS12575 WP_088117570.1 2560484..2560831(-) (comGE) [Bacillus atrophaeus strain SRCM101359]
MWKENKGFSTIETVAALSTWVLITVMILPLWARLISDEKETAIQETGYQLLHESISTYMLSGEYGKSETIKRLNQTYKVR
WEEDGDNQKVCMEAVSPKDEPFCLSILRTDWLYPS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=231297 S101359_RS12575 WP_088117570.1 2560484..2560831(-) (comGE) [Bacillus atrophaeus strain SRCM101359]
ATGTGGAAAGAAAATAAAGGCTTCTCAACAATTGAAACAGTCGCGGCTTTAAGCACTTGGGTATTGATTACAGTGATGAT
TCTTCCTTTGTGGGCCAGACTGATATCAGATGAAAAAGAGACAGCCATTCAGGAAACCGGTTATCAGCTTCTTCACGAAA
GCATCAGTACATACATGCTTTCTGGAGAGTACGGAAAATCAGAGACAATAAAAAGGCTGAACCAAACCTATAAGGTCAGG
TGGGAGGAGGATGGCGACAATCAAAAAGTATGTATGGAAGCGGTCAGCCCGAAGGACGAGCCCTTTTGTCTCAGCATTCT
TCGGACAGACTGGTTATACCCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

51.304

100

0.513

Multiple sequence alignment