Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   S101359_RS12530 Genome accession   NZ_CP021500
Coordinates   2555983..2556156 (+) Length   57 a.a.
NCBI ID   WP_003325442.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain SRCM101359     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2550983..2561156
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S101359_RS12515 (S101359_02470) gcvT 2551753..2552847 (-) 1095 WP_088117565.1 glycine cleavage system aminomethyltransferase GcvT -
  S101359_RS12520 (S101359_02471) - 2553308..2554978 (+) 1671 WP_088117566.1 SNF2-related protein -
  S101359_RS12525 (S101359_02472) - 2554999..2555793 (+) 795 WP_003325443.1 YqhG family protein -
  S101359_RS12530 (S101359_02473) sinI 2555983..2556156 (+) 174 WP_003325442.1 anti-repressor SinI family protein Regulator
  S101359_RS12535 (S101359_02474) sinR 2556190..2556525 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  S101359_RS12540 (S101359_02475) - 2556716..2557498 (-) 783 WP_063638541.1 TasA family protein -
  S101359_RS12545 (S101359_02476) - 2557562..2558134 (-) 573 WP_010789195.1 signal peptidase I -
  S101359_RS12550 (S101359_02477) tapA 2558118..2558819 (-) 702 WP_088117567.1 amyloid fiber anchoring/assembly protein TapA -
  S101359_RS12555 (S101359_02478) - 2559081..2559404 (+) 324 WP_088117568.1 DUF3889 domain-containing protein -
  S101359_RS12560 (S101359_02479) - 2559451..2559630 (-) 180 WP_003325435.1 YqzE family protein -
  S101359_RS12565 (S101359_02480) comGG 2559700..2560074 (-) 375 WP_088117569.1 competence type IV pilus minor pilin ComGG Machinery gene
  S101359_RS12570 (S101359_02481) comGF 2560075..2560581 (-) 507 WP_274379311.1 competence type IV pilus minor pilin ComGF -
  S101359_RS12575 (S101359_02482) comGE 2560484..2560831 (-) 348 WP_088117570.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6813.90 Da        Isoelectric Point: 10.0469

>NTDB_id=231294 S101359_RS12530 WP_003325442.1 2555983..2556156(+) (sinI) [Bacillus atrophaeus strain SRCM101359]
MKNAKKELLELDQEWVELMKRAREANINPEEIRKYLYLHKKSAHPVPATRSHTINPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=231294 S101359_RS12530 WP_003325442.1 2555983..2556156(+) (sinI) [Bacillus atrophaeus strain SRCM101359]
ATGAAAAATGCAAAAAAAGAGCTTTTAGAATTAGATCAAGAATGGGTTGAATTAATGAAAAGAGCCAGAGAAGCAAATAT
CAACCCGGAGGAGATACGCAAATATTTATATTTGCATAAAAAGTCTGCTCATCCTGTCCCAGCCACCAGAAGTCATACCA
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

78.947

100

0.789

Multiple sequence alignment