Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   B9N48_RS15870 Genome accession   NZ_CP021169
Coordinates   3023670..3023810 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain TLO3     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3018670..3028810
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B9N48_RS15845 yuxO 3018983..3019363 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  B9N48_RS15850 comA 3019382..3020026 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  B9N48_RS15855 comP 3020107..3022416 (-) 2310 WP_086344258.1 two-component system sensor histidine kinase ComP Regulator
  B9N48_RS15860 comX 3022431..3022598 (-) 168 WP_038828676.1 competence pheromone ComX Regulator
  B9N48_RS15865 comQ 3022586..3023485 (-) 900 WP_086344259.1 polyprenyl synthetase family protein Regulator
  B9N48_RS15870 degQ 3023670..3023810 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  B9N48_RS20705 - 3024032..3024157 (+) 126 WP_003228793.1 hypothetical protein -
  B9N48_RS15875 - 3024272..3024640 (+) 369 WP_017695529.1 hypothetical protein -
  B9N48_RS15880 pdeH 3024616..3025845 (-) 1230 WP_049140563.1 cyclic di-GMP phosphodiesterase -
  B9N48_RS15885 pncB 3025982..3027454 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  B9N48_RS15890 pncA 3027470..3028021 (-) 552 WP_086344260.1 isochorismatase family cysteine hydrolase -
  B9N48_RS15895 yueI 3028118..3028516 (-) 399 WP_032726794.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=228796 B9N48_RS15870 WP_003220708.1 3023670..3023810(-) (degQ) [Bacillus subtilis strain TLO3]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=228796 B9N48_RS15870 WP_003220708.1 3023670..3023810(-) (degQ) [Bacillus subtilis strain TLO3]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment