Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   B9N48_RS15860 Genome accession   NZ_CP021169
Coordinates   3022431..3022598 (-) Length   55 a.a.
NCBI ID   WP_038828676.1    Uniprot ID   I2D9X2
Organism   Bacillus subtilis strain TLO3     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3017431..3027598
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B9N48_RS15830 mrpE 3017826..3018302 (+) 477 WP_003228815.1 Na+/H+ antiporter subunit E -
  B9N48_RS15835 mrpF 3018302..3018586 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  B9N48_RS15840 mnhG 3018570..3018944 (+) 375 WP_015714623.1 monovalent cation/H(+) antiporter subunit G -
  B9N48_RS15845 yuxO 3018983..3019363 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  B9N48_RS15850 comA 3019382..3020026 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  B9N48_RS15855 comP 3020107..3022416 (-) 2310 WP_086344258.1 two-component system sensor histidine kinase ComP Regulator
  B9N48_RS15860 comX 3022431..3022598 (-) 168 WP_038828676.1 competence pheromone ComX Regulator
  B9N48_RS15865 comQ 3022586..3023485 (-) 900 WP_086344259.1 polyprenyl synthetase family protein Regulator
  B9N48_RS15870 degQ 3023670..3023810 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  B9N48_RS20705 - 3024032..3024157 (+) 126 WP_003228793.1 hypothetical protein -
  B9N48_RS15875 - 3024272..3024640 (+) 369 WP_017695529.1 hypothetical protein -
  B9N48_RS15880 pdeH 3024616..3025845 (-) 1230 WP_049140563.1 cyclic di-GMP phosphodiesterase -
  B9N48_RS15885 pncB 3025982..3027454 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6561.45 Da        Isoelectric Point: 4.5668

>NTDB_id=228794 B9N48_RS15860 WP_038828676.1 3022431..3022598(-) (comX) [Bacillus subtilis strain TLO3]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYRADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=228794 B9N48_RS15860 WP_038828676.1 3022431..3022598(-) (comX) [Bacillus subtilis strain TLO3]
GTGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATTGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCGGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2D9X2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

98.182

100

0.982


Multiple sequence alignment