Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | B9P52_RS04700 | Genome accession | NZ_CP020917 |
| Coordinates | 1024763..1025257 (+) | Length | 164 a.a. |
| NCBI ID | WP_088446212.1 | Uniprot ID | - |
| Organism | Achromobacter denitrificans strain PR1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 988394..1029863 | 1024763..1025257 | within | 0 |
Gene organization within MGE regions
Location: 988394..1029863
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B9P52_RS04460 (B9P52_04460) | - | 988394..989377 (+) | 984 | WP_088446168.1 | tyrosine-type recombinase/integrase | - |
| B9P52_RS04465 (B9P52_04465) | - | 989380..989598 (+) | 219 | WP_088446169.1 | hypothetical protein | - |
| B9P52_RS04470 (B9P52_04470) | - | 989595..990113 (-) | 519 | WP_088446170.1 | hypothetical protein | - |
| B9P52_RS04475 (B9P52_04475) | - | 990110..990640 (-) | 531 | WP_088446171.1 | hypothetical protein | - |
| B9P52_RS04485 (B9P52_04485) | - | 991053..992021 (-) | 969 | WP_157672698.1 | Bro-N domain-containing protein | - |
| B9P52_RS04490 (B9P52_04490) | - | 992103..992267 (-) | 165 | WP_088446174.1 | Arc family DNA-binding protein | - |
| B9P52_RS04495 (B9P52_04495) | - | 992414..992932 (+) | 519 | WP_088446175.1 | Arc family DNA-binding protein | - |
| B9P52_RS04500 (B9P52_04500) | - | 992929..993303 (+) | 375 | WP_088446176.1 | hypothetical protein | - |
| B9P52_RS32195 | - | 993300..993461 (+) | 162 | WP_157672699.1 | hypothetical protein | - |
| B9P52_RS04505 (B9P52_04505) | - | 993462..996092 (-) | 2631 | WP_088446177.1 | glycoside hydrolase family 104 protein | - |
| B9P52_RS04510 (B9P52_04510) | - | 996092..997255 (-) | 1164 | WP_157672700.1 | hypothetical protein | - |
| B9P52_RS04515 (B9P52_04515) | - | 997264..997998 (-) | 735 | WP_088446179.1 | hypothetical protein | - |
| B9P52_RS04520 (B9P52_04520) | - | 998009..999145 (-) | 1137 | WP_088446180.1 | hypothetical protein | - |
| B9P52_RS04525 (B9P52_04525) | - | 999142..999558 (-) | 417 | WP_157672701.1 | hypothetical protein | - |
| B9P52_RS04530 (B9P52_04530) | - | 999555..1000958 (-) | 1404 | WP_088446182.1 | hypothetical protein | - |
| B9P52_RS04535 (B9P52_04535) | - | 1000959..1001663 (-) | 705 | WP_088446183.1 | hypothetical protein | - |
| B9P52_RS04540 (B9P52_04540) | - | 1001660..1002670 (-) | 1011 | WP_088446184.1 | collagen-like protein | - |
| B9P52_RS04545 (B9P52_04545) | - | 1002667..1002966 (-) | 300 | WP_088446185.1 | phage holin family protein | - |
| B9P52_RS04550 (B9P52_04550) | - | 1002968..1003327 (-) | 360 | WP_088446186.1 | putative holin | - |
| B9P52_RS32200 | - | 1003379..1003798 (-) | 420 | WP_157672702.1 | hypothetical protein | - |
| B9P52_RS04560 (B9P52_04560) | - | 1004707..1005246 (+) | 540 | WP_088446188.1 | hypothetical protein | - |
| B9P52_RS04565 (B9P52_04565) | - | 1005300..1005746 (-) | 447 | WP_198317977.1 | hypothetical protein | - |
| B9P52_RS04570 (B9P52_04570) | - | 1005800..1006846 (-) | 1047 | WP_088446189.1 | phage major capsid protein | - |
| B9P52_RS04575 (B9P52_04575) | - | 1007159..1008256 (-) | 1098 | WP_088446190.1 | hypothetical protein | - |
| B9P52_RS04580 (B9P52_04580) | - | 1008266..1010326 (-) | 2061 | WP_198317978.1 | hypothetical protein | - |
| B9P52_RS04585 (B9P52_04585) | - | 1010329..1011753 (-) | 1425 | WP_088446191.1 | terminase large subunit domain-containing protein | - |
| B9P52_RS04590 (B9P52_04590) | - | 1011750..1012430 (-) | 681 | WP_157672703.1 | terminase small subunit | - |
| B9P52_RS04595 (B9P52_04595) | - | 1012459..1012731 (-) | 273 | WP_088446193.1 | hypothetical protein | - |
| B9P52_RS04600 (B9P52_04600) | - | 1012735..1013244 (-) | 510 | WP_088446194.1 | hypothetical protein | - |
| B9P52_RS04605 (B9P52_04605) | - | 1013241..1014053 (-) | 813 | WP_232482040.1 | RusA family crossover junction endodeoxyribonuclease | - |
| B9P52_RS04610 (B9P52_04610) | - | 1014050..1014991 (-) | 942 | WP_088446195.1 | AAA family ATPase | - |
| B9P52_RS04615 (B9P52_04615) | - | 1014988..1015374 (-) | 387 | WP_232482041.1 | hypothetical protein | - |
| B9P52_RS04620 (B9P52_04620) | - | 1015356..1016168 (-) | 813 | WP_088446196.1 | hypothetical protein | - |
| B9P52_RS04625 (B9P52_04625) | - | 1016168..1016575 (-) | 408 | WP_232482042.1 | hypothetical protein | - |
| B9P52_RS04630 (B9P52_04630) | - | 1016620..1017078 (-) | 459 | WP_088446198.1 | recombination protein NinB | - |
| B9P52_RS04635 (B9P52_04635) | - | 1017080..1017394 (-) | 315 | WP_088446199.1 | CII family transcriptional regulator | - |
| B9P52_RS32480 (B9P52_04640) | - | 1017433..1017597 (+) | 165 | WP_088446200.1 | hypothetical protein | - |
| B9P52_RS04645 (B9P52_04645) | - | 1017603..1017827 (-) | 225 | WP_088446201.1 | helix-turn-helix domain-containing protein | - |
| B9P52_RS04650 (B9P52_04650) | - | 1017901..1018602 (+) | 702 | WP_198317979.1 | S24 family peptidase | - |
| B9P52_RS04655 (B9P52_04655) | - | 1018615..1019625 (+) | 1011 | WP_157672704.1 | hypothetical protein | - |
| B9P52_RS04660 (B9P52_04660) | - | 1019807..1020445 (+) | 639 | WP_088446204.1 | pentapeptide repeat-containing protein | - |
| B9P52_RS04665 (B9P52_04665) | - | 1020481..1020780 (+) | 300 | WP_088446205.1 | hypothetical protein | - |
| B9P52_RS04670 (B9P52_04670) | - | 1020784..1021149 (+) | 366 | WP_088446206.1 | hypothetical protein | - |
| B9P52_RS04675 (B9P52_04675) | - | 1021238..1021972 (+) | 735 | WP_088446207.1 | hypothetical protein | - |
| B9P52_RS04680 (B9P52_04680) | - | 1021980..1022159 (+) | 180 | WP_088446208.1 | hypothetical protein | - |
| B9P52_RS04685 (B9P52_04685) | - | 1022161..1023258 (+) | 1098 | WP_088446209.1 | hypothetical protein | - |
| B9P52_RS04690 (B9P52_04690) | - | 1023266..1024099 (+) | 834 | WP_088446210.1 | hypothetical protein | - |
| B9P52_RS04695 (B9P52_04695) | - | 1024092..1024763 (+) | 672 | WP_088446211.1 | hypothetical protein | - |
| B9P52_RS04700 (B9P52_04700) | ssb | 1024763..1025257 (+) | 495 | WP_088446212.1 | single-stranded DNA-binding protein | Machinery gene |
| B9P52_RS32205 | - | 1025267..1025740 (+) | 474 | WP_157672705.1 | hypothetical protein | - |
| B9P52_RS32210 | - | 1025811..1025960 (+) | 150 | WP_157672706.1 | hypothetical protein | - |
| B9P52_RS04705 (B9P52_04705) | - | 1025963..1026370 (+) | 408 | WP_088446213.1 | hypothetical protein | - |
| B9P52_RS04710 (B9P52_04710) | - | 1026370..1027182 (+) | 813 | WP_088446214.1 | hypothetical protein | - |
| B9P52_RS04715 (B9P52_04715) | - | 1027179..1028342 (+) | 1164 | WP_088446215.1 | hypothetical protein | - |
| B9P52_RS04720 (B9P52_04720) | - | 1028335..1028847 (+) | 513 | WP_088446216.1 | class I SAM-dependent methyltransferase | - |
| B9P52_RS04725 (B9P52_04725) | - | 1028840..1029142 (+) | 303 | WP_088446217.1 | ASCH domain-containing protein | - |
| B9P52_RS04730 (B9P52_04730) | - | 1029135..1029350 (+) | 216 | WP_088446218.1 | hypothetical protein | - |
| B9P52_RS04735 (B9P52_04735) | - | 1029400..1029633 (+) | 234 | WP_088446219.1 | hypothetical protein | - |
| B9P52_RS04740 (B9P52_04740) | - | 1029630..1029863 (+) | 234 | WP_054460707.1 | helix-turn-helix transcriptional regulator | - |
Sequence
Protein
Download Length: 164 a.a. Molecular weight: 18280.29 Da Isoelectric Point: 5.3809
>NTDB_id=227135 B9P52_RS04700 WP_088446212.1 1024763..1025257(+) (ssb) [Achromobacter denitrificans strain PR1]
MASVNKVILVGNLGRDPEVRYTPDGAAICNMSIATTSSWKDKASGEKRDETEWHRVVMYSRLAEIAGEYLKKGRSVYIEG
RLKTRKWQDKDTGADRYSTEIIADQMQMLGGRDEGDSAPPERQPQRAPAQRPTSQRNEYAEQSGAGRPQTPGAALDDFDS
EIPF
MASVNKVILVGNLGRDPEVRYTPDGAAICNMSIATTSSWKDKASGEKRDETEWHRVVMYSRLAEIAGEYLKKGRSVYIEG
RLKTRKWQDKDTGADRYSTEIIADQMQMLGGRDEGDSAPPERQPQRAPAQRPTSQRNEYAEQSGAGRPQTPGAALDDFDS
EIPF
Nucleotide
Download Length: 495 bp
>NTDB_id=227135 B9P52_RS04700 WP_088446212.1 1024763..1025257(+) (ssb) [Achromobacter denitrificans strain PR1]
ATGGCCAGCGTCAACAAGGTCATCCTGGTGGGCAACTTGGGCCGCGACCCGGAAGTCCGCTACACCCCCGACGGGGCGGC
AATCTGCAACATGTCTATAGCCACCACCTCAAGCTGGAAAGACAAAGCCAGCGGCGAGAAGCGGGACGAAACTGAATGGC
ATCGAGTCGTCATGTATAGCCGCTTGGCGGAGATCGCCGGCGAGTACTTGAAGAAGGGCCGCTCGGTCTACATCGAGGGC
CGGCTCAAGACGCGCAAGTGGCAGGACAAGGACACGGGCGCCGACCGCTACAGCACCGAAATCATCGCCGACCAGATGCA
AATGTTGGGTGGGCGCGACGAGGGCGACAGTGCGCCGCCTGAGCGCCAGCCGCAGCGCGCGCCGGCACAACGCCCGACGA
GCCAGCGCAACGAGTACGCCGAACAAAGCGGTGCAGGACGTCCCCAGACCCCGGGGGCAGCGTTGGACGATTTCGACAGC
GAAATTCCATTCTGA
ATGGCCAGCGTCAACAAGGTCATCCTGGTGGGCAACTTGGGCCGCGACCCGGAAGTCCGCTACACCCCCGACGGGGCGGC
AATCTGCAACATGTCTATAGCCACCACCTCAAGCTGGAAAGACAAAGCCAGCGGCGAGAAGCGGGACGAAACTGAATGGC
ATCGAGTCGTCATGTATAGCCGCTTGGCGGAGATCGCCGGCGAGTACTTGAAGAAGGGCCGCTCGGTCTACATCGAGGGC
CGGCTCAAGACGCGCAAGTGGCAGGACAAGGACACGGGCGCCGACCGCTACAGCACCGAAATCATCGCCGACCAGATGCA
AATGTTGGGTGGGCGCGACGAGGGCGACAGTGCGCCGCCTGAGCGCCAGCCGCAGCGCGCGCCGGCACAACGCCCGACGA
GCCAGCGCAACGAGTACGCCGAACAAAGCGGTGCAGGACGTCCCCAGACCCCGGGGGCAGCGTTGGACGATTTCGACAGC
GAAATTCCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
50.556 |
100 |
0.555 |
| ssb | Glaesserella parasuis strain SC1401 |
48.066 |
100 |
0.53 |
| ssb | Neisseria gonorrhoeae MS11 |
48.864 |
100 |
0.524 |
| ssb | Neisseria meningitidis MC58 |
48 |
100 |
0.512 |