Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | B9C53_RS17855 | Genome accession | NZ_CP020874 |
| Coordinates | 3632074..3632247 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain GYL4 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3627074..3637247
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B9C53_RS17805 (B9C53_17745) | comGD | 3627193..3627630 (+) | 438 | WP_038459181.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| B9C53_RS17810 (B9C53_17750) | comGE | 3627614..3627928 (+) | 315 | WP_038459179.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| B9C53_RS17815 (B9C53_17755) | comGF | 3627837..3628337 (+) | 501 | WP_228842201.1 | competence type IV pilus minor pilin ComGF | - |
| B9C53_RS17820 (B9C53_17760) | comGG | 3628338..3628715 (+) | 378 | WP_038459177.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| B9C53_RS17825 (B9C53_17765) | - | 3628772..3628951 (+) | 180 | WP_022552966.1 | YqzE family protein | - |
| B9C53_RS17830 (B9C53_17770) | - | 3628992..3629321 (-) | 330 | WP_038459175.1 | DUF3889 domain-containing protein | - |
| B9C53_RS17835 (B9C53_17775) | tapA | 3629580..3630251 (+) | 672 | WP_108655004.1 | amyloid fiber anchoring/assembly protein TapA | - |
| B9C53_RS17840 (B9C53_17780) | sipW | 3630223..3630807 (+) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| B9C53_RS17845 (B9C53_17785) | tasA | 3630872..3631657 (+) | 786 | WP_044802563.1 | biofilm matrix protein TasA | - |
| B9C53_RS17850 (B9C53_17790) | sinR | 3631705..3632040 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| B9C53_RS17855 (B9C53_17795) | sinI | 3632074..3632247 (-) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| B9C53_RS17860 (B9C53_17800) | - | 3632424..3633218 (-) | 795 | WP_015240204.1 | YqhG family protein | - |
| B9C53_RS17865 (B9C53_17805) | - | 3633240..3634910 (-) | 1671 | WP_108655005.1 | DEAD/DEAH box helicase | - |
| B9C53_RS17870 (B9C53_17810) | gcvT | 3635334..3636435 (+) | 1102 | Protein_3436 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=226809 B9C53_RS17855 WP_003153105.1 3632074..3632247(-) (sinI) [Bacillus velezensis strain GYL4]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=226809 B9C53_RS17855 WP_003153105.1 3632074..3632247(-) (sinI) [Bacillus velezensis strain GYL4]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |