Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   B9C53_RS17810 Genome accession   NZ_CP020874
Coordinates   3627614..3627928 (+) Length   104 a.a.
NCBI ID   WP_038459179.1    Uniprot ID   -
Organism   Bacillus velezensis strain GYL4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3622614..3632928
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B9C53_RS17785 (B9C53_17725) - 3623649..3624599 (+) 951 WP_032874012.1 magnesium transporter CorA family protein -
  B9C53_RS17790 (B9C53_17730) comGA 3624796..3625866 (+) 1071 WP_038459186.1 competence type IV pilus ATPase ComGA Machinery gene
  B9C53_RS17795 (B9C53_17735) comGB 3625853..3626890 (+) 1038 WP_038459183.1 competence type IV pilus assembly protein ComGB Machinery gene
  B9C53_RS17800 (B9C53_17740) comGC 3626937..3627203 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  B9C53_RS17805 (B9C53_17745) comGD 3627193..3627630 (+) 438 WP_038459181.1 competence type IV pilus minor pilin ComGD Machinery gene
  B9C53_RS17810 (B9C53_17750) comGE 3627614..3627928 (+) 315 WP_038459179.1 competence type IV pilus minor pilin ComGE Machinery gene
  B9C53_RS17815 (B9C53_17755) comGF 3627837..3628337 (+) 501 WP_228842201.1 competence type IV pilus minor pilin ComGF -
  B9C53_RS17820 (B9C53_17760) comGG 3628338..3628715 (+) 378 WP_038459177.1 competence type IV pilus minor pilin ComGG Machinery gene
  B9C53_RS17825 (B9C53_17765) - 3628772..3628951 (+) 180 WP_022552966.1 YqzE family protein -
  B9C53_RS17830 (B9C53_17770) - 3628992..3629321 (-) 330 WP_038459175.1 DUF3889 domain-containing protein -
  B9C53_RS17835 (B9C53_17775) tapA 3629580..3630251 (+) 672 WP_108655004.1 amyloid fiber anchoring/assembly protein TapA -
  B9C53_RS17840 (B9C53_17780) sipW 3630223..3630807 (+) 585 WP_012117977.1 signal peptidase I SipW -
  B9C53_RS17845 (B9C53_17785) tasA 3630872..3631657 (+) 786 WP_044802563.1 biofilm matrix protein TasA -
  B9C53_RS17850 (B9C53_17790) sinR 3631705..3632040 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  B9C53_RS17855 (B9C53_17795) sinI 3632074..3632247 (-) 174 WP_003153105.1 anti-repressor SinI Regulator

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11932.91 Da        Isoelectric Point: 5.8321

>NTDB_id=226806 B9C53_RS17810 WP_038459179.1 3627614..3627928(+) (comGE) [Bacillus velezensis strain GYL4]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRSEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=226806 B9C53_RS17810 WP_038459179.1 3627614..3627928(+) (comGE) [Bacillus velezensis strain GYL4]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCAGCGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment