Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   B7941_RS14540 Genome accession   NZ_CP020805
Coordinates   2970286..2970663 (-) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus velezensis strain 9D-6     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2965286..2975663
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B7941_RS14500 (B7941_14485) - 2965784..2966578 (+) 795 WP_007612541.1 YqhG family protein -
  B7941_RS14505 (B7941_14490) sinI 2966755..2966928 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  B7941_RS14510 (B7941_14495) sinR 2966962..2967297 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  B7941_RS14515 (B7941_14500) tasA 2967345..2968130 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  B7941_RS14520 (B7941_14505) sipW 2968210..2968779 (-) 570 WP_085342188.1 signal peptidase I SipW -
  B7941_RS14525 (B7941_14510) tapA 2968751..2969422 (-) 672 WP_085342189.1 amyloid fiber anchoring/assembly protein TapA -
  B7941_RS14530 (B7941_14515) - 2969681..2970010 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  B7941_RS14535 (B7941_14520) - 2970050..2970229 (-) 180 WP_003153093.1 YqzE family protein -
  B7941_RS14540 (B7941_14525) comGG 2970286..2970663 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  B7941_RS14545 (B7941_14530) comGF 2970664..2971164 (-) 501 WP_257474763.1 competence type IV pilus minor pilin ComGF -
  B7941_RS14550 (B7941_14535) comGE 2971073..2971387 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  B7941_RS14555 (B7941_14540) comGD 2971371..2971808 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene
  B7941_RS14560 (B7941_14545) comGC 2971798..2972106 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  B7941_RS14565 (B7941_14550) comGB 2972111..2973148 (-) 1038 WP_085342190.1 competence type IV pilus assembly protein ComGB Machinery gene
  B7941_RS14570 (B7941_14555) comGA 2973135..2974205 (-) 1071 WP_085342191.1 competence type IV pilus ATPase ComGA Machinery gene
  B7941_RS14575 (B7941_14560) - 2974402..2975352 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=225959 B7941_RS14540 WP_012117980.1 2970286..2970663(-) (comGG) [Bacillus velezensis strain 9D-6]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=225959 B7941_RS14540 WP_012117980.1 2970286..2970663(-) (comGG) [Bacillus velezensis strain 9D-6]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment