Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | B7941_RS14505 | Genome accession | NZ_CP020805 |
| Coordinates | 2966755..2966928 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain 9D-6 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2961755..2971928
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B7941_RS14490 (B7941_14475) | gcvT | 2962568..2963668 (-) | 1101 | WP_032866432.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| B7941_RS14495 (B7941_14480) | - | 2964092..2965762 (+) | 1671 | WP_031378948.1 | DEAD/DEAH box helicase | - |
| B7941_RS14500 (B7941_14485) | - | 2965784..2966578 (+) | 795 | WP_007612541.1 | YqhG family protein | - |
| B7941_RS14505 (B7941_14490) | sinI | 2966755..2966928 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| B7941_RS14510 (B7941_14495) | sinR | 2966962..2967297 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| B7941_RS14515 (B7941_14500) | tasA | 2967345..2968130 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| B7941_RS14520 (B7941_14505) | sipW | 2968210..2968779 (-) | 570 | WP_085342188.1 | signal peptidase I SipW | - |
| B7941_RS14525 (B7941_14510) | tapA | 2968751..2969422 (-) | 672 | WP_085342189.1 | amyloid fiber anchoring/assembly protein TapA | - |
| B7941_RS14530 (B7941_14515) | - | 2969681..2970010 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| B7941_RS14535 (B7941_14520) | - | 2970050..2970229 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| B7941_RS14540 (B7941_14525) | comGG | 2970286..2970663 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| B7941_RS14545 (B7941_14530) | comGF | 2970664..2971164 (-) | 501 | WP_257474763.1 | competence type IV pilus minor pilin ComGF | - |
| B7941_RS14550 (B7941_14535) | comGE | 2971073..2971387 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| B7941_RS14555 (B7941_14540) | comGD | 2971371..2971808 (-) | 438 | WP_043020787.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=225957 B7941_RS14505 WP_003153105.1 2966755..2966928(+) (sinI) [Bacillus velezensis strain 9D-6]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=225957 B7941_RS14505 WP_003153105.1 2966755..2966928(+) (sinI) [Bacillus velezensis strain 9D-6]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |