Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   B7L44_RS03535 Genome accession   NZ_CP020588
Coordinates   705663..706016 (-) Length   117 a.a.
NCBI ID   WP_032040895.1    Uniprot ID   -
Organism   Acinetobacter nosocomialis strain SSA3     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 703297..735722 705663..706016 within 0


Gene organization within MGE regions


Location: 703297..735722
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B7L44_RS03515 (B7L44_03515) - 703297..704364 (+) 1068 WP_000107856.1 tyrosine-type recombinase/integrase -
  B7L44_RS03520 (B7L44_03520) - 704393..704689 (-) 297 WP_000218943.1 hypothetical protein -
  B7L44_RS03525 (B7L44_03525) - 704686..704907 (-) 222 WP_005136253.1 hypothetical protein -
  B7L44_RS03530 (B7L44_03530) - 704916..705653 (-) 738 WP_083008261.1 3'-5' exonuclease -
  B7L44_RS03535 (B7L44_03535) ssb 705663..706016 (-) 354 WP_032040895.1 single-stranded DNA-binding protein Machinery gene
  B7L44_RS03540 (B7L44_03540) - 706004..706321 (-) 318 WP_032040896.1 hypothetical protein -
  B7L44_RS20145 - 706314..706484 (-) 171 WP_130066700.1 hypothetical protein -
  B7L44_RS03545 (B7L44_03545) - 706474..706917 (-) 444 WP_032040897.1 DUF2528 family protein -
  B7L44_RS03550 (B7L44_03550) - 706985..707197 (-) 213 WP_016804027.1 hypothetical protein -
  B7L44_RS03555 (B7L44_03555) - 707216..707551 (-) 336 WP_032040898.1 hypothetical protein -
  B7L44_RS03560 (B7L44_03560) - 707548..710286 (-) 2739 WP_083008262.1 toprim domain-containing protein -
  B7L44_RS03565 (B7L44_03565) - 710380..710571 (-) 192 WP_032040900.1 hypothetical protein -
  B7L44_RS03570 (B7L44_03570) - 710664..711005 (+) 342 WP_000786717.1 helix-turn-helix domain-containing protein -
  B7L44_RS03575 (B7L44_03575) - 711050..711265 (-) 216 WP_000556347.1 hypothetical protein -
  B7L44_RS03580 (B7L44_03580) - 711366..711611 (-) 246 WP_032040901.1 hypothetical protein -
  B7L44_RS03585 (B7L44_03585) - 711614..711808 (-) 195 WP_032040902.1 hypothetical protein -
  B7L44_RS03590 (B7L44_03590) - 712123..712857 (+) 735 WP_032040903.1 hypothetical protein -
  B7L44_RS03595 (B7L44_03595) - 712930..713676 (+) 747 WP_032040904.1 hypothetical protein -
  B7L44_RS03605 (B7L44_03605) - 713973..714173 (-) 201 WP_000130086.1 TraR/DksA C4-type zinc finger protein -
  B7L44_RS03610 (B7L44_03610) - 714170..714409 (-) 240 WP_000113727.1 ogr/Delta-like zinc finger family protein -
  B7L44_RS03615 (B7L44_03615) - 714539..715852 (-) 1314 WP_032040906.1 contractile injection system protein, VgrG/Pvc8 family -
  B7L44_RS03620 (B7L44_03620) - 715853..716293 (-) 441 WP_083008263.1 phage tail protein -
  B7L44_RS03625 (B7L44_03625) - 716298..718748 (-) 2451 WP_083008264.1 phage tail tape measure protein -
  B7L44_RS20590 (B7L44_03630) - 718762..718875 (-) 114 WP_074166825.1 GpE family phage tail protein -
  B7L44_RS03635 (B7L44_03635) - 718902..719243 (-) 342 WP_001071617.1 phage tail assembly protein -
  B7L44_RS03640 (B7L44_03640) - 719310..719828 (-) 519 WP_031987639.1 phage major tail tube protein -
  B7L44_RS03645 (B7L44_03645) - 719841..721016 (-) 1176 WP_032040908.1 phage tail sheath protein -
  B7L44_RS03650 (B7L44_03650) - 721122..723422 (-) 2301 WP_083008265.1 phage tail protein -
  B7L44_RS20430 (B7L44_03655) - 723434..723622 (-) 189 Protein_680 phage tail protein I -
  B7L44_RS03660 (B7L44_03660) - 723645..724346 (-) 702 WP_005157712.1 IS1-like element ISPa14 family transposase -
  B7L44_RS03665 (B7L44_03665) - 724407..724835 (-) 429 Protein_682 phage tail protein I -
  B7L44_RS03670 (B7L44_03670) - 724835..725737 (-) 903 WP_032047665.1 baseplate J/gp47 family protein -
  B7L44_RS03675 (B7L44_03675) - 725734..726081 (-) 348 WP_032047666.1 GPW/gp25 family protein -
  B7L44_RS03680 (B7L44_03680) - 726078..726704 (-) 627 WP_032047667.1 phage baseplate assembly protein V -
  B7L44_RS03685 (B7L44_03685) - 726777..727226 (-) 450 WP_032040914.1 phage virion morphogenesis protein -
  B7L44_RS03690 (B7L44_03690) - 727223..727750 (-) 528 WP_024436840.1 phage tail protein -
  B7L44_RS03695 (B7L44_03695) - 727747..728577 (-) 831 WP_024436839.1 N-acetylmuramidase domain-containing protein -
  B7L44_RS03700 (B7L44_03700) - 728574..728843 (-) 270 WP_024436838.1 phage holin family protein -
  B7L44_RS03705 (B7L44_03705) - 728840..729190 (-) 351 WP_001114936.1 putative holin -
  B7L44_RS03710 (B7L44_03710) - 729199..729411 (-) 213 WP_032040915.1 tail protein X -
  B7L44_RS03715 (B7L44_03715) - 729404..729637 (-) 234 WP_083008267.1 hypothetical protein -
  B7L44_RS03720 (B7L44_03720) - 729637..730089 (-) 453 WP_032040917.1 head completion/stabilization protein -
  B7L44_RS03725 (B7L44_03725) gpM 730192..730956 (-) 765 WP_032040918.1 phage terminase small subunit -
  B7L44_RS03730 (B7L44_03730) - 730967..731956 (-) 990 WP_039244373.1 phage major capsid protein, P2 family -
  B7L44_RS03735 (B7L44_03735) - 731971..732774 (-) 804 WP_032014584.1 GPO family capsid scaffolding protein -
  B7L44_RS03740 (B7L44_03740) - 732930..734714 (+) 1785 WP_032014581.1 terminase large subunit domain-containing protein -
  B7L44_RS03745 (B7L44_03745) - 734715..735722 (+) 1008 WP_032040920.1 phage portal protein -

Sequence

Protein


Download         Length: 117 a.a.        Molecular weight: 13300.00 Da        Isoelectric Point: 9.4655

>NTDB_id=224551 B7L44_RS03535 WP_032040895.1 705663..706016(-) (ssb) [Acinetobacter nosocomialis strain SSA3]
MRGINKVILVGVLGANPIPKQFQNGGSYAQFSIATSEKYQDKHTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQDRYVTEVRAITFQSLDSLPQANPV

Nucleotide


Download         Length: 354 bp        

>NTDB_id=224551 B7L44_RS03535 WP_032040895.1 705663..706016(-) (ssb) [Acinetobacter nosocomialis strain SSA3]
ATGCGTGGAATAAATAAAGTGATTTTGGTCGGTGTGCTTGGTGCCAATCCAATTCCTAAACAGTTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACACACTGGTGACTGGATTGAAAATACAGAGTGGC
ATCGGATTGTTGCCCACAACCGACTAGGTGAAATTGCCTGCCAATTTCTTAAAAAAGGTTCAAAAGTTTATATCGAAGGG
TCATTACATACACGGAAATGGACTGACCAAAACAATCAAGACCGTTACGTAACTGAAGTTAGAGCCATTACTTTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-106)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

56.364

94.017

0.53
  ssb Vibrio cholerae strain A1552

55.556

84.615

0.47
  ssb Neisseria gonorrhoeae MS11

40.952

89.744

0.368
  ssb Neisseria meningitidis MC58

40.952

89.744

0.368

Multiple sequence alignment