Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   A6J57_RS09575 Genome accession   NZ_CP020405
Coordinates   2050808..2051257 (-) Length   149 a.a.
NCBI ID   WP_005756690.1    Uniprot ID   -
Organism   Pasteurella multocida strain FDAARGOS_218     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2046416..2107384 2050808..2051257 within 0


Gene organization within MGE regions


Location: 2046416..2107384
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A6J57_RS09535 (A6J57_09520) - 2046416..2047447 (-) 1032 WP_005756705.1 tyrosine-type recombinase/integrase -
  A6J57_RS09540 (A6J57_09525) - 2047449..2047700 (-) 252 WP_032854027.1 DUF4224 domain-containing protein -
  A6J57_RS11050 - 2047737..2048063 (-) 327 WP_005756703.1 hypothetical protein -
  A6J57_RS11105 - 2048067..2048540 (-) 474 WP_005756701.1 hypothetical protein -
  A6J57_RS09555 (A6J57_09535) - 2048605..2048835 (-) 231 WP_005756699.1 hypothetical protein -
  A6J57_RS09560 (A6J57_09540) - 2048845..2049129 (-) 285 WP_005756697.1 DUF6378 domain-containing protein -
  A6J57_RS11055 - 2049126..2049284 (-) 159 WP_005756695.1 hypothetical protein -
  A6J57_RS09565 (A6J57_09545) - 2049348..2049986 (-) 639 WP_005756693.1 Bro-N domain-containing protein -
  A6J57_RS09570 (A6J57_09550) - 2050288..2050695 (-) 408 WP_032854026.1 GNAT family N-acetyltransferase -
  A6J57_RS09575 (A6J57_09555) ssb 2050808..2051257 (-) 450 WP_005756690.1 single-stranded DNA-binding protein Machinery gene
  A6J57_RS09580 (A6J57_09560) - 2051268..2051888 (-) 621 WP_005756689.1 ERF family protein -
  A6J57_RS11110 (A6J57_09565) - 2052084..2052695 (-) 612 WP_005756687.1 antA/AntB antirepressor family protein -
  A6J57_RS09590 (A6J57_09570) - 2053036..2054061 (-) 1026 WP_005756686.1 hypothetical protein -
  A6J57_RS09595 (A6J57_09575) - 2054144..2054794 (-) 651 WP_005756684.1 ribonuclease H-like domain-containing protein -
  A6J57_RS09600 (A6J57_09580) - 2054797..2055384 (-) 588 WP_005756682.1 hypothetical protein -
  A6J57_RS11070 - 2055558..2055719 (-) 162 WP_005756680.1 hypothetical protein -
  A6J57_RS09605 (A6J57_09585) - 2055732..2055959 (-) 228 WP_032854021.1 hypothetical protein -
  A6J57_RS09610 (A6J57_09590) - 2055946..2056236 (-) 291 WP_005756670.1 hypothetical protein -
  A6J57_RS09615 (A6J57_09595) - 2056322..2056948 (-) 627 WP_005756667.1 BRO family protein -
  A6J57_RS09620 (A6J57_09600) - 2057368..2058624 (-) 1257 WP_032854019.1 hypothetical protein -
  A6J57_RS09625 (A6J57_09605) - 2058707..2059504 (-) 798 WP_032854018.1 hypothetical protein -
  A6J57_RS09630 (A6J57_09610) - 2059622..2060086 (-) 465 WP_050547907.1 DUF4760 domain-containing protein -
  A6J57_RS09635 (A6J57_09615) - 2060539..2060766 (-) 228 WP_032854017.1 hypothetical protein -
  A6J57_RS09640 (A6J57_09620) - 2061009..2061218 (-) 210 WP_005756656.1 hypothetical protein -
  A6J57_RS09645 (A6J57_09625) - 2061231..2061398 (+) 168 WP_005756653.1 DUF1508 domain-containing protein -
  A6J57_RS09650 (A6J57_09630) - 2061709..2062023 (+) 315 WP_005756650.1 type II toxin-antitoxin system RelE/ParE family toxin -
  A6J57_RS09655 (A6J57_09635) - 2062020..2062310 (+) 291 WP_005756647.1 addiction module antidote protein -
  A6J57_RS09660 (A6J57_09640) - 2062334..2063041 (-) 708 WP_005756645.1 MAE_28990/MAE_18760 family HEPN-like nuclease -
  A6J57_RS09665 (A6J57_09645) - 2063038..2064105 (-) 1068 WP_005756643.1 DUF262 domain-containing protein -
  A6J57_RS09670 (A6J57_09650) - 2064149..2064838 (-) 690 WP_005756642.1 helix-turn-helix transcriptional regulator -
  A6J57_RS09675 (A6J57_09655) - 2064966..2065175 (+) 210 WP_005720263.1 helix-turn-helix transcriptional regulator -
  A6J57_RS09680 (A6J57_09660) - 2065196..2065471 (+) 276 WP_005756640.1 hypothetical protein -
  A6J57_RS09685 (A6J57_09665) - 2065474..2065881 (-) 408 WP_032854015.1 hypothetical protein -
  A6J57_RS09690 (A6J57_09670) - 2065988..2066233 (+) 246 WP_005725517.1 helix-turn-helix domain-containing protein -
  A6J57_RS09695 (A6J57_09675) - 2066311..2067129 (+) 819 WP_005756636.1 hypothetical protein -
  A6J57_RS09700 (A6J57_09680) - 2067126..2068484 (+) 1359 WP_005756635.1 replicative DNA helicase -
  A6J57_RS09705 (A6J57_09685) - 2068487..2068912 (+) 426 WP_005756633.1 recombination protein NinB -
  A6J57_RS09710 (A6J57_09690) - 2069003..2069221 (+) 219 WP_005756632.1 hypothetical protein -
  A6J57_RS09715 (A6J57_09695) - 2069221..2069817 (+) 597 WP_005756630.1 recombination protein NinG -
  A6J57_RS09720 (A6J57_09700) - 2069817..2070182 (+) 366 WP_005756628.1 antiterminator Q family protein -
  A6J57_RS09725 (A6J57_09705) - 2070259..2071176 (+) 918 WP_080527702.1 DUF4747 family protein -
  A6J57_RS09730 (A6J57_09710) - 2071186..2071761 (+) 576 WP_005756625.1 hypothetical protein -
  A6J57_RS09735 (A6J57_09715) - 2072237..2072854 (+) 618 WP_032854013.1 KilA-N domain-containing protein -
  A6J57_RS09740 (A6J57_09720) - 2073122..2073457 (+) 336 WP_005756621.1 hypothetical protein -
  A6J57_RS09745 (A6J57_09725) - 2073468..2074019 (+) 552 WP_005756619.1 hypothetical protein -
  A6J57_RS09750 (A6J57_09730) - 2074134..2074499 (+) 366 WP_032854011.1 phage holin, lambda family -
  A6J57_RS09755 (A6J57_09735) - 2074471..2075055 (+) 585 WP_005756617.1 glycoside hydrolase family 19 protein -
  A6J57_RS09760 (A6J57_09740) - 2075058..2075381 (+) 324 WP_005756616.1 DUF2570 family protein -
  A6J57_RS09770 (A6J57_09750) - 2075600..2076034 (-) 435 WP_005756614.1 type II toxin-antitoxin system HicB family antitoxin -
  A6J57_RS09775 (A6J57_09755) - 2076063..2076245 (-) 183 WP_016533497.1 type II toxin-antitoxin system HicA family toxin -
  A6J57_RS09780 (A6J57_09760) - 2076328..2076864 (+) 537 WP_005756612.1 terminase small subunit -
  A6J57_RS09785 (A6J57_09765) - 2076848..2078080 (+) 1233 WP_005756610.1 PBSX family phage terminase large subunit -
  A6J57_RS09790 (A6J57_09770) - 2078090..2079493 (+) 1404 WP_005756608.1 DUF4055 domain-containing protein -
  A6J57_RS09795 (A6J57_09775) - 2079483..2081084 (+) 1602 WP_005756605.1 minor capsid protein -
  A6J57_RS09800 (A6J57_09780) - 2081087..2081305 (+) 219 WP_005756603.1 hypothetical protein -
  A6J57_RS09805 (A6J57_09785) - 2081280..2081714 (+) 435 WP_005756601.1 HD domain-containing protein -
  A6J57_RS11075 - 2081754..2081921 (+) 168 WP_169319011.1 hypothetical protein -
  A6J57_RS09810 (A6J57_09790) - 2082050..2082835 (+) 786 WP_005756599.1 hypothetical protein -
  A6J57_RS09815 (A6J57_09795) - 2082853..2084010 (+) 1158 WP_005756598.1 P22 phage major capsid protein family protein -
  A6J57_RS09820 (A6J57_09800) - 2084067..2084303 (+) 237 WP_005756596.1 HeH/LEM domain-containing protein -
  A6J57_RS09825 (A6J57_09805) - 2084320..2084787 (+) 468 WP_032854009.1 DnaT-like ssDNA-binding protein -
  A6J57_RS09830 (A6J57_09810) - 2084789..2085175 (+) 387 WP_032854007.1 hypothetical protein -
  A6J57_RS09835 (A6J57_09815) - 2085177..2085578 (+) 402 WP_005756593.1 HK97 gp10 family phage protein -
  A6J57_RS09840 (A6J57_09820) - 2085578..2085916 (+) 339 WP_226891716.1 phage tail terminator-like protein -
  A6J57_RS09845 (A6J57_09825) - 2085983..2086999 (+) 1017 WP_005756589.1 phage tail tube protein -
  A6J57_RS09850 (A6J57_09830) - 2087073..2087477 (+) 405 WP_005756587.1 hypothetical protein -
  A6J57_RS11115 - 2087624..2087815 (+) 192 WP_226891717.1 hypothetical protein -
  A6J57_RS09860 (A6J57_09840) - 2087823..2088149 (+) 327 WP_015691082.1 phage tail protein -
  A6J57_RS09865 (A6J57_09845) - 2088167..2091430 (+) 3264 WP_005756581.1 tape measure protein -
  A6J57_RS09870 (A6J57_09850) - 2091527..2092081 (+) 555 WP_005756579.1 membrane lipoprotein lipid attachment site-containing protein -
  A6J57_RS11080 - 2092189..2092362 (+) 174 WP_165544714.1 hypothetical protein -
  A6J57_RS09875 (A6J57_09855) - 2092557..2093075 (+) 519 WP_005756575.1 hypothetical protein -
  A6J57_RS09880 (A6J57_09860) - 2093077..2093571 (+) 495 WP_032854005.1 type VI secretion system-associated protein TagO -
  A6J57_RS09885 (A6J57_09865) - 2093691..2095649 (+) 1959 WP_005756571.1 ATP-binding protein -
  A6J57_RS09890 (A6J57_09870) - 2095743..2096714 (-) 972 WP_005756570.1 P63C domain-containing protein -
  A6J57_RS09895 (A6J57_09875) - 2097085..2097909 (+) 825 WP_032854004.1 phage antirepressor N-terminal domain-containing protein -
  A6J57_RS09900 (A6J57_09880) - 2098107..2098631 (+) 525 WP_005756566.1 Rha family transcriptional regulator -
  A6J57_RS09905 (A6J57_09885) - 2098659..2099309 (+) 651 WP_005756565.1 phage minor tail protein L -
  A6J57_RS09910 (A6J57_09890) - 2099311..2100033 (+) 723 WP_005756564.1 C40 family peptidase -
  A6J57_RS09915 (A6J57_09895) - 2100062..2100676 (+) 615 WP_005756561.1 tail assembly protein -
  A6J57_RS09920 (A6J57_09900) - 2100680..2104327 (+) 3648 WP_005756560.1 host specificity protein J -
  A6J57_RS09925 (A6J57_09905) - 2104341..2105423 (+) 1083 WP_005756558.1 pyocin knob domain-containing protein -
  A6J57_RS09930 (A6J57_09910) - 2105433..2106020 (+) 588 WP_005756557.1 DUF4376 domain-containing protein -
  A6J57_RS09935 (A6J57_09915) - 2106010..2106267 (+) 258 WP_005756556.1 hypothetical protein -
  A6J57_RS09940 (A6J57_09920) - 2106542..2107384 (-) 843 WP_005726500.1 patatin family protein -

Sequence


Protein


Download         Length: 149 a.a.        Molecular weight: 16787.65 Da        Isoelectric Point: 7.9778

>NTDB_id=222282 A6J57_RS09575 WP_005756690.1 2050808..2051257(-) (ssb) [Pasteurella multocida strain FDAARGOS_218]
MAGVNRVIILGNLGNDPDVRTMPNGDAVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQPQQAPAPQNNAYANAKAGKPVQQADSFEENSIPF

Nucleotide


Download         Length: 450 bp        

>NTDB_id=222282 A6J57_RS09575 WP_005756690.1 2050808..2051257(-) (ssb) [Pasteurella multocida strain FDAARGOS_218]
ATGGCTGGGGTTAATCGTGTAATTATTTTAGGAAATTTAGGAAACGATCCTGATGTCCGCACAATGCCAAATGGCGACGC
AGTGGCAAAAATTAGTGTGGCCACGAGCGAAAGTTGGATCGACAAAAACACGAACGAGCGAAAAACGCAGACAGAATGGC
ACTCTATCGTGTTTTATCGCCGCCAAGCAGAAATTTGCGGGCAATATCTCAAGAAAGGCTCAAAAGTGTATGTAGAAGGA
CGTTTAAAAACTCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAACCGCAGCAAGCACCAGCACCACAAAACAATGCTTATGCCAATGCGAAAGCTGGAA
AGCCAGTGCAGCAAGCAGACAGCTTTGAAGAAAATAGTATTCCGTTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

62.431

100

0.758

  ssb Vibrio cholerae strain A1552

52.667

100

0.53

  ssb Neisseria gonorrhoeae MS11

45.652

92.617

0.423

  ssb Neisseria meningitidis MC58

45.652

92.617

0.423


Multiple sequence alignment