Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   A6J55_RS08395 Genome accession   NZ_CP020403
Coordinates   1752234..1752734 (-) Length   166 a.a.
NCBI ID   WP_005725039.1    Uniprot ID   A0A379BD60
Organism   Pasteurella multocida strain FDAARGOS_216     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1705863..1759594 1752234..1752734 within 0


Gene organization within MGE regions


Location: 1705863..1759594
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A6J55_RS08085 (A6J55_08085) - 1705863..1706747 (+) 885 WP_005755551.1 septal ring lytic transglycosylase RlpA family protein -
  A6J55_RS08090 (A6J55_08090) - 1706774..1707958 (+) 1185 WP_005752389.1 serine hydrolase -
  A6J55_RS08095 (A6J55_08095) ybeD 1708061..1708357 (+) 297 WP_005719420.1 DUF493 family protein YbeD -
  A6J55_RS08100 (A6J55_08100) lipB 1708364..1709020 (+) 657 WP_005755554.1 lipoyl(octanoyl) transferase LipB -
  A6J55_RS08105 (A6J55_08105) lipA 1709085..1710047 (+) 963 WP_005755556.1 lipoyl synthase -
  A6J55_RS08110 (A6J55_08110) - 1710125..1710544 (-) 420 WP_005719426.1 DUF417 family protein -
  A6J55_RS08115 (A6J55_08115) - 1710847..1711692 (-) 846 WP_005755558.1 hypothetical protein -
  A6J55_RS08120 (A6J55_08120) - 1711844..1712104 (-) 261 WP_005755559.1 Gp49 family protein -
  A6J55_RS08125 (A6J55_08125) - 1712170..1714971 (-) 2802 WP_005755561.1 phage tail protein -
  A6J55_RS08130 (A6J55_08130) - 1714971..1715171 (-) 201 WP_005755563.1 hypothetical protein -
  A6J55_RS08135 (A6J55_08135) - 1715175..1715426 (-) 252 WP_005755565.1 hypothetical protein -
  A6J55_RS08140 (A6J55_08140) - 1715443..1716252 (-) 810 WP_005755567.1 phage BR0599 family protein -
  A6J55_RS08145 (A6J55_08145) - 1716277..1717956 (-) 1680 WP_005755569.1 hypothetical protein -
  A6J55_RS08150 (A6J55_08150) - 1717964..1718926 (-) 963 WP_005755570.1 hypothetical protein -
  A6J55_RS08155 (A6J55_08155) - 1718928..1719920 (-) 993 WP_005755572.1 hypothetical protein -
  A6J55_RS08160 (A6J55_08160) - 1719931..1723269 (-) 3339 WP_005755574.1 tape measure protein -
  A6J55_RS08165 (A6J55_08165) - 1723282..1723497 (+) 216 WP_005755576.1 hypothetical protein -
  A6J55_RS08175 (A6J55_08175) - 1723708..1724133 (-) 426 WP_005755578.1 DUF6631 family protein -
  A6J55_RS08180 (A6J55_08180) - 1724194..1724940 (-) 747 WP_005755580.1 hypothetical protein -
  A6J55_RS08185 (A6J55_08185) - 1724933..1725193 (-) 261 WP_005755582.1 hypothetical protein -
  A6J55_RS08190 (A6J55_08190) - 1725190..1725636 (-) 447 WP_005755583.1 hypothetical protein -
  A6J55_RS08195 (A6J55_08195) - 1725636..1726142 (-) 507 WP_005755584.1 gp436 family protein -
  A6J55_RS08200 (A6J55_08200) - 1726152..1727075 (-) 924 WP_005755585.1 hypothetical protein -
  A6J55_RS08205 (A6J55_08205) - 1727137..1727502 (-) 366 WP_005755586.1 capsid cement protein -
  A6J55_RS08210 (A6J55_08210) - 1727499..1728500 (-) 1002 WP_005755587.1 hypothetical protein -
  A6J55_RS08215 (A6J55_08215) - 1728718..1729218 (-) 501 WP_005755588.1 phage virion morphogenesis protein -
  A6J55_RS08220 (A6J55_08220) - 1729316..1730554 (-) 1239 WP_005755589.1 PBECR2 nuclease fold domain-containing protein -
  A6J55_RS08225 (A6J55_08225) - 1730538..1732061 (-) 1524 WP_005755590.1 DUF935 domain-containing protein -
  A6J55_RS08230 (A6J55_08230) - 1732064..1733632 (-) 1569 WP_005755591.1 terminase large subunit domain-containing protein -
  A6J55_RS08235 (A6J55_08235) - 1733632..1734174 (-) 543 WP_005755592.1 DUF3486 family protein -
  A6J55_RS08240 (A6J55_08240) - 1734186..1734491 (-) 306 WP_005755593.1 hypothetical protein -
  A6J55_RS08245 (A6J55_08245) - 1734493..1734843 (-) 351 WP_005755594.1 hypothetical protein -
  A6J55_RS10845 - 1734940..1735383 (-) 444 WP_192940804.1 hypothetical protein -
  A6J55_RS08255 (A6J55_08255) - 1735374..1735970 (-) 597 WP_005755599.1 transglycosylase SLT domain-containing protein -
  A6J55_RS08260 (A6J55_08260) - 1735972..1736343 (-) 372 WP_005755602.1 putative holin -
  A6J55_RS08265 (A6J55_08265) - 1736563..1737741 (-) 1179 WP_005755605.1 hypothetical protein -
  A6J55_RS08270 (A6J55_08270) - 1737741..1738709 (-) 969 WP_005755607.1 nucleoid-associated protein -
  A6J55_RS08275 (A6J55_08275) - 1738848..1739093 (-) 246 WP_005755610.1 hypothetical protein -
  A6J55_RS08280 (A6J55_08280) - 1739151..1739741 (-) 591 WP_005755613.1 hypothetical protein -
  A6J55_RS08285 (A6J55_08285) - 1739754..1740281 (-) 528 WP_032851711.1 hypothetical protein -
  A6J55_RS08290 (A6J55_08290) - 1740312..1740722 (-) 411 WP_005755617.1 helix-turn-helix domain-containing protein -
  A6J55_RS10850 - 1740899..1741126 (-) 228 WP_025248436.1 hypothetical protein -
  A6J55_RS08295 (A6J55_08295) - 1741191..1741427 (+) 237 WP_005755620.1 DNA-binding protein -
  A6J55_RS08300 (A6J55_08300) - 1741507..1741692 (+) 186 WP_005755622.1 hypothetical protein -
  A6J55_RS08305 (A6J55_08305) - 1741705..1742019 (+) 315 WP_005755623.1 hypothetical protein -
  A6J55_RS08310 (A6J55_08310) - 1742030..1742974 (+) 945 WP_005755624.1 hypothetical protein -
  A6J55_RS08315 (A6J55_08315) - 1742986..1744755 (+) 1770 WP_005755626.1 DDE-type integrase/transposase/recombinase -
  A6J55_RS08320 (A6J55_08320) - 1744767..1745945 (+) 1179 WP_005755628.1 AAA family ATPase -
  A6J55_RS08325 (A6J55_08325) - 1745948..1746271 (+) 324 WP_005755630.1 hypothetical protein -
  A6J55_RS08330 (A6J55_08330) - 1746281..1746502 (+) 222 WP_005755632.1 hypothetical protein -
  A6J55_RS08335 (A6J55_08335) - 1746477..1746731 (+) 255 WP_032851712.1 hypothetical protein -
  A6J55_RS08340 (A6J55_08340) - 1746751..1747371 (+) 621 WP_005755634.1 DUF3164 family protein -
  A6J55_RS10855 - 1747373..1747540 (+) 168 WP_005755636.1 hypothetical protein -
  A6J55_RS08345 (A6J55_08345) - 1747541..1747768 (+) 228 WP_005755637.1 hypothetical protein -
  A6J55_RS08350 (A6J55_08350) - 1747815..1748375 (+) 561 WP_005755639.1 DUF5420 family protein -
  A6J55_RS08355 (A6J55_08355) - 1748377..1748676 (+) 300 WP_005755641.1 hypothetical protein -
  A6J55_RS08360 (A6J55_08360) - 1748673..1749233 (+) 561 WP_005755643.1 YfbR-like 5'-deoxynucleotidase -
  A6J55_RS08365 (A6J55_08365) - 1749309..1749773 (+) 465 WP_032851747.1 gp16 family protein -
  A6J55_RS08370 (A6J55_08370) - 1749773..1750117 (+) 345 WP_005755647.1 Mor transcription activator family protein -
  A6J55_RS08385 (A6J55_08385) folD 1750874..1751728 (+) 855 WP_005752391.1 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD -
  A6J55_RS08395 (A6J55_08395) ssb 1752234..1752734 (-) 501 WP_005725039.1 single-stranded DNA-binding protein Machinery gene
  A6J55_RS08400 (A6J55_08400) uvrA 1752906..1755737 (+) 2832 WP_005755649.1 excinuclease ABC subunit UvrA -
  A6J55_RS08405 (A6J55_08405) sodC 1755808..1756368 (+) 561 WP_005725042.1 superoxide dismutase family protein -
  A6J55_RS08410 (A6J55_08410) rlmB 1756454..1757191 (-) 738 WP_005725044.1 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB -
  A6J55_RS08415 (A6J55_08415) rnr 1757192..1759594 (-) 2403 WP_005752404.1 ribonuclease R -

Sequence


Protein


Download         Length: 166 a.a.        Molecular weight: 18657.68 Da        Isoelectric Point: 5.3353

>NTDB_id=222253 A6J55_RS08395 WP_005725039.1 1752234..1752734(-) (ssb) [Pasteurella multocida strain FDAARGOS_216]
MAGVNKVIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTNERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRNERQQTGGYAPQTAAPQYNAPTGGYGAQPSRPATKPAPQNEPPMDMGFE
EDNIPF

Nucleotide


Download         Length: 501 bp        

>NTDB_id=222253 A6J55_RS08395 WP_005725039.1 1752234..1752734(-) (ssb) [Pasteurella multocida strain FDAARGOS_216]
ATGGCTGGAGTAAATAAAGTAATTATTGTAGGGAACTTAGGTAACGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
CGTAGCCAATATCAGCGTCGCGACCAGTGAAAGCTGGATCGACAAAAATACTAACGAACGTCGTGAAGTCACCGAATGGC
ATCGCATCGTATTCTACCGTCGCCAAGCTGAAGTGGCTGGGGAATATCTGCGTAAAGGTTCAAAAGTGTATGTAGAAGGA
CGCCTAAAAACCCGTAAATGGCAAGACCAAAATGGGCAAGACCGCTACACTACCGAGATCCAAGGCGACGTGTTACAAAT
GCTCGACAGCCGTAACGAACGTCAACAAACCGGCGGCTACGCCCCACAAACCGCTGCGCCACAATATAATGCCCCAACAG
GTGGCTACGGTGCACAACCTTCTCGTCCAGCGACAAAACCCGCTCCACAAAACGAACCTCCAATGGACATGGGCTTTGAG
GAAGATAATATTCCGTTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A379BD60

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

69.231

100

0.759

  ssb Vibrio cholerae strain A1552

53.591

100

0.584

  ssb Neisseria meningitidis MC58

44.068

100

0.47

  ssb Neisseria gonorrhoeae MS11

44.068

100

0.47


Multiple sequence alignment