Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | B5S52_RS03915 | Genome accession | NZ_CP020350 |
| Coordinates | 865681..866223 (-) | Length | 180 a.a. |
| NCBI ID | WP_039283288.1 | Uniprot ID | A0A433N4B3 |
| Organism | Pectobacterium brasiliense strain SX309 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 864763..907900 | 865681..866223 | within | 0 |
Gene organization within MGE regions
Location: 864763..907900
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B5S52_RS03910 (B5S52_03910) | - | 864911..865525 (+) | 615 | WP_039497843.1 | hypothetical protein | - |
| B5S52_RS03915 (B5S52_03915) | ssb | 865681..866223 (-) | 543 | WP_039283288.1 | single-stranded DNA-binding protein SSB1 | Machinery gene |
| B5S52_RS03920 (B5S52_03920) | uvrA | 866473..869307 (+) | 2835 | WP_014916582.1 | excinuclease ABC subunit UvrA | - |
| B5S52_RS03925 (B5S52_03925) | - | 869323..869742 (+) | 420 | WP_039497841.1 | secondary thiamine-phosphate synthase enzyme YjbQ | - |
| B5S52_RS03930 (B5S52_03930) | cas6f | 870418..870972 (-) | 555 | WP_039497838.1 | type I-F CRISPR-associated endoribonuclease Cas6/Csy4 | - |
| B5S52_RS03935 (B5S52_03935) | csy3 | 870982..871992 (-) | 1011 | WP_039509854.1 | type I-F CRISPR-associated protein Csy3 | - |
| B5S52_RS03940 (B5S52_03940) | - | 872193..872585 (-) | 393 | WP_080163222.1 | Mor transcription activator family protein | - |
| B5S52_RS03945 (B5S52_03945) | - | 872582..873004 (-) | 423 | WP_080163224.1 | gp16 family protein | - |
| B5S52_RS03950 (B5S52_03950) | - | 872982..873182 (-) | 201 | WP_039528298.1 | hypothetical protein | - |
| B5S52_RS03955 (B5S52_03955) | - | 873179..873481 (-) | 303 | WP_155121802.1 | hypothetical protein | - |
| B5S52_RS03960 (B5S52_03960) | - | 873572..874156 (-) | 585 | WP_039305356.1 | DUF3164 family protein | - |
| B5S52_RS03965 (B5S52_03965) | - | 874198..874467 (-) | 270 | WP_080163226.1 | hypothetical protein | - |
| B5S52_RS03970 (B5S52_03970) | - | 874495..874752 (-) | 258 | WP_080163228.1 | hypothetical protein | - |
| B5S52_RS03975 (B5S52_03975) | - | 874755..875906 (-) | 1152 | WP_080163231.1 | ExeA family protein | - |
| B5S52_RS03980 (B5S52_03980) | - | 875916..877685 (-) | 1770 | WP_080163233.1 | DDE-type integrase/transposase/recombinase | - |
| B5S52_RS03985 (B5S52_03985) | - | 877695..878603 (-) | 909 | WP_080163235.1 | DUF3102 domain-containing protein | - |
| B5S52_RS03990 (B5S52_03990) | - | 878613..878918 (-) | 306 | WP_011095206.1 | helix-turn-helix domain-containing protein | - |
| B5S52_RS03995 (B5S52_03995) | - | 878971..879159 (-) | 189 | WP_080163237.1 | DNA-binding protein | - |
| B5S52_RS04000 (B5S52_04000) | - | 879251..879667 (+) | 417 | WP_080163239.1 | helix-turn-helix domain-containing protein | - |
| B5S52_RS04005 (B5S52_04005) | - | 879686..880216 (+) | 531 | WP_080163241.1 | hypothetical protein | - |
| B5S52_RS04010 (B5S52_04010) | - | 880256..881200 (+) | 945 | WP_080163243.1 | hypothetical protein | - |
| B5S52_RS04015 (B5S52_04015) | - | 881320..882327 (+) | 1008 | WP_080163245.1 | nucleoid-associated protein | - |
| B5S52_RS04020 (B5S52_04020) | - | 882330..883511 (+) | 1182 | WP_080163247.1 | hypothetical protein | - |
| B5S52_RS04025 (B5S52_04025) | - | 883676..884020 (+) | 345 | WP_080163249.1 | putative holin | - |
| B5S52_RS04030 (B5S52_04030) | - | 884023..884751 (+) | 729 | WP_080163251.1 | transglycosylase SLT domain-containing protein | - |
| B5S52_RS04035 (B5S52_04035) | - | 884735..885406 (+) | 672 | WP_080163253.1 | hypothetical protein | - |
| B5S52_RS04040 (B5S52_04040) | - | 885406..885738 (+) | 333 | WP_039528360.1 | hypothetical protein | - |
| B5S52_RS04045 (B5S52_04045) | - | 885731..886042 (+) | 312 | WP_039528362.1 | hypothetical protein | - |
| B5S52_RS04050 (B5S52_04050) | - | 886044..886589 (+) | 546 | WP_080163255.1 | DUF3486 family protein | - |
| B5S52_RS04055 (B5S52_04055) | - | 886586..888109 (+) | 1524 | WP_080163256.1 | terminase large subunit domain-containing protein | - |
| B5S52_RS04060 (B5S52_04060) | - | 888109..889602 (+) | 1494 | WP_080163257.1 | DUF935 domain-containing protein | - |
| B5S52_RS04065 (B5S52_04065) | - | 889583..890404 (+) | 822 | WP_080163259.1 | phage minor head protein | - |
| B5S52_RS04070 (B5S52_04070) | - | 890401..890850 (+) | 450 | WP_080163261.1 | phage virion morphogenesis protein | - |
| B5S52_RS04075 (B5S52_04075) | - | 891046..892155 (+) | 1110 | WP_080163263.1 | peptidase | - |
| B5S52_RS04080 (B5S52_04080) | - | 892192..893127 (+) | 936 | WP_080163266.1 | hypothetical protein | - |
| B5S52_RS04085 (B5S52_04085) | - | 893138..893476 (+) | 339 | WP_080163268.1 | capsid cement protein | - |
| B5S52_RS04090 (B5S52_04090) | - | 893479..893925 (+) | 447 | WP_080163270.1 | gp436 family protein | - |
| B5S52_RS04095 (B5S52_04095) | - | 893925..894392 (+) | 468 | WP_080163272.1 | Gp37 family protein | - |
| B5S52_RS04100 (B5S52_04100) | - | 894386..894613 (+) | 228 | WP_080163274.1 | hypothetical protein | - |
| B5S52_RS04105 (B5S52_04105) | - | 894603..896030 (+) | 1428 | WP_080163276.1 | phage tail sheath subtilisin-like domain-containing protein | - |
| B5S52_RS04110 (B5S52_04110) | - | 896030..896554 (+) | 525 | WP_011095230.1 | phage major tail tube protein | - |
| B5S52_RS04115 (B5S52_04115) | - | 896719..897021 (+) | 303 | WP_080163278.1 | phage tail assembly protein | - |
| B5S52_RS04125 (B5S52_04125) | - | 897096..897365 (-) | 270 | WP_080163280.1 | hypothetical protein | - |
| B5S52_RS04130 (B5S52_04130) | - | 897408..899879 (+) | 2472 | WP_080163283.1 | phage tail tape measure protein | - |
| B5S52_RS04135 (B5S52_04135) | - | 899879..900763 (+) | 885 | WP_080163285.1 | phage tail protein | - |
| B5S52_RS04140 (B5S52_04140) | - | 900760..900975 (+) | 216 | WP_080163287.1 | tail protein X | - |
| B5S52_RS04145 (B5S52_04145) | - | 900963..902114 (+) | 1152 | WP_080163290.1 | phage late control D family protein | - |
| B5S52_RS04150 (B5S52_04150) | - | 902111..902704 (+) | 594 | WP_080163292.1 | phage baseplate assembly protein V | - |
| B5S52_RS04155 (B5S52_04155) | - | 902731..903588 (+) | 858 | WP_080163294.1 | AbiJ-NTD4 domain-containing protein | - |
| B5S52_RS04160 (B5S52_04160) | - | 903654..904001 (+) | 348 | WP_080163296.1 | GPW/gp25 family protein | - |
| B5S52_RS04165 (B5S52_04165) | - | 903992..905098 (+) | 1107 | WP_080163298.1 | baseplate assembly protein | - |
| B5S52_RS04170 (B5S52_04170) | - | 905091..905666 (+) | 576 | WP_080163301.1 | phage tail protein | - |
| B5S52_RS04175 (B5S52_04175) | - | 905667..907283 (+) | 1617 | WP_080163303.1 | tail fiber protein | - |
| B5S52_RS04180 (B5S52_04180) | - | 907283..907900 (+) | 618 | WP_080163305.1 | tail fiber assembly protein | - |
Sequence
Protein
Download Length: 180 a.a. Molecular weight: 19115.08 Da Isoelectric Point: 5.2456
>NTDB_id=221555 B5S52_RS03915 WP_039283288.1 865681..866223(-) (ssb) [Pectobacterium brasiliense strain SX309]
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKQTGEQKEKTEWHRVVLFGKLAEVAGEYLRKGSQVYI
EGALQTRKWADQAGVERYTTEVVVNVGGTMQMLGGRQGGGAPAGGNAGGGQQQGGWGQPQQPQGGNQFSGGAQSQQRPAQ
NSAPAQSNEPPMDFDDDIPF
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKQTGEQKEKTEWHRVVLFGKLAEVAGEYLRKGSQVYI
EGALQTRKWADQAGVERYTTEVVVNVGGTMQMLGGRQGGGAPAGGNAGGGQQQGGWGQPQQPQGGNQFSGGAQSQQRPAQ
NSAPAQSNEPPMDFDDDIPF
Nucleotide
Download Length: 543 bp
>NTDB_id=221555 B5S52_RS03915 WP_039283288.1 865681..866223(-) (ssb) [Pectobacterium brasiliense strain SX309]
ATGGCCAGCAGAGGCGTTAATAAAGTGATTCTTGTCGGGAATCTGGGTCAAGACCCGGAAGTCCGCTATATGCCGAATGG
TGGTGCAGTTGCCAACATCACGCTGGCTACGTCGGAAAGCTGGCGTGACAAGCAAACCGGTGAGCAGAAAGAGAAGACTG
AATGGCACCGTGTCGTGCTGTTCGGCAAACTGGCAGAAGTCGCGGGCGAATACCTGCGCAAAGGCTCTCAGGTTTACATC
GAAGGCGCACTGCAAACCCGTAAATGGGCCGATCAGGCTGGCGTAGAGCGCTACACCACCGAAGTCGTCGTTAACGTCGG
CGGCACCATGCAGATGCTGGGTGGACGCCAGGGCGGCGGCGCACCAGCAGGCGGTAACGCAGGTGGCGGTCAGCAACAAG
GCGGTTGGGGTCAACCTCAGCAGCCGCAGGGCGGCAACCAGTTCAGCGGCGGCGCGCAATCTCAACAGCGCCCTGCACAG
AACAGCGCTCCAGCACAAAGCAACGAACCGCCAATGGATTTCGACGACGATATTCCGTTCTAA
ATGGCCAGCAGAGGCGTTAATAAAGTGATTCTTGTCGGGAATCTGGGTCAAGACCCGGAAGTCCGCTATATGCCGAATGG
TGGTGCAGTTGCCAACATCACGCTGGCTACGTCGGAAAGCTGGCGTGACAAGCAAACCGGTGAGCAGAAAGAGAAGACTG
AATGGCACCGTGTCGTGCTGTTCGGCAAACTGGCAGAAGTCGCGGGCGAATACCTGCGCAAAGGCTCTCAGGTTTACATC
GAAGGCGCACTGCAAACCCGTAAATGGGCCGATCAGGCTGGCGTAGAGCGCTACACCACCGAAGTCGTCGTTAACGTCGG
CGGCACCATGCAGATGCTGGGTGGACGCCAGGGCGGCGGCGCACCAGCAGGCGGTAACGCAGGTGGCGGTCAGCAACAAG
GCGGTTGGGGTCAACCTCAGCAGCCGCAGGGCGGCAACCAGTTCAGCGGCGGCGCGCAATCTCAACAGCGCCCTGCACAG
AACAGCGCTCCAGCACAAAGCAACGAACCGCCAATGGATTTCGACGACGATATTCCGTTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
72.193 |
100 |
0.75 |
| ssb | Glaesserella parasuis strain SC1401 |
57.297 |
100 |
0.589 |
| ssb | Neisseria meningitidis MC58 |
46.369 |
99.444 |
0.461 |
| ssb | Neisseria gonorrhoeae MS11 |
46.369 |
99.444 |
0.461 |