Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | BV139_RS00485 | Genome accession | NZ_CP020012 |
| Coordinates | 98109..98531 (+) | Length | 140 a.a. |
| NCBI ID | WP_005687556.1 | Uniprot ID | A0A377IYS1 |
| Organism | Haemophilus influenzae strain 6P24H2 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 90337..135337 | 98109..98531 | within | 0 |
Gene organization within MGE regions
Location: 90337..135337
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BV139_RS00445 (BV139_90) | - | 90477..91313 (+) | 837 | WP_005653598.1 | ParA family protein | - |
| BV139_RS00450 (BV139_91) | dnaB | 91315..92670 (+) | 1356 | WP_005687545.1 | replicative DNA helicase | - |
| BV139_RS00455 (BV139_92) | - | 92663..94363 (+) | 1701 | WP_005687547.1 | ParB family protein | - |
| BV139_RS00460 (BV139_93) | - | 94363..94914 (+) | 552 | WP_005653590.1 | DUF2857 domain-containing protein | - |
| BV139_RS00465 (BV139_94) | - | 95064..96287 (+) | 1224 | WP_005687549.1 | STY4528 family pathogenicity island replication protein | - |
| BV139_RS00470 | - | 96304..96603 (+) | 300 | WP_005687551.1 | hypothetical protein | - |
| BV139_RS00475 (BV139_95) | - | 96620..97375 (+) | 756 | WP_005687553.1 | PFL_4669 family integrating conjugative element protein | - |
| BV139_RS00480 (BV139_96) | - | 97390..97863 (+) | 474 | WP_005653583.1 | DUF3158 family protein | - |
| BV139_RS00485 (BV139_97) | ssb | 98109..98531 (+) | 423 | WP_005687556.1 | single-stranded DNA-binding protein | Machinery gene |
| BV139_RS00490 (BV139_98) | - | 98558..99076 (+) | 519 | WP_005687559.1 | membrane lipoprotein lipid attachment site-containing protein | - |
| BV139_RS00495 (BV139_99) | - | 99292..99849 (-) | 558 | WP_005687561.1 | plasmid fertility inhibition factor family protein | - |
| BV139_RS00500 (BV139_100) | - | 99940..101985 (+) | 2046 | WP_005687564.1 | DNA topoisomerase III | - |
| BV139_RS00505 (BV139_101) | - | 102870..103298 (+) | 429 | WP_005687566.1 | STY4534 family ICE replication protein | - |
| BV139_RS00510 (BV139_102) | - | 103413..104054 (+) | 642 | WP_005687569.1 | DUF3560 domain-containing protein | - |
| BV139_RS00515 (BV139_103) | - | 104349..104945 (+) | 597 | WP_005687571.1 | hypothetical protein | - |
| BV139_RS00520 (BV139_104) | - | 105003..105767 (+) | 765 | WP_233993154.1 | TraX family protein | - |
| BV139_RS00525 (BV139_105) | - | 105866..106495 (+) | 630 | WP_005687574.1 | lipoprotein | - |
| BV139_RS00530 (BV139_106) | - | 106499..107239 (+) | 741 | WP_005687576.1 | TIGR03759 family integrating conjugative element protein | - |
| BV139_RS00535 (BV139_107) | - | 107218..107976 (+) | 759 | WP_005687578.1 | transglycosylase SLT domain-containing protein | - |
| BV139_RS00540 (BV139_108) | - | 107992..108498 (+) | 507 | WP_005687579.1 | integrating conjugative element protein | - |
| BV139_RS00545 (BV139_109) | traD | 108495..110744 (+) | 2250 | WP_005687580.1 | type IV conjugative transfer system coupling protein TraD | - |
| BV139_RS00550 (BV139_110) | - | 110728..111063 (+) | 336 | WP_005687581.1 | hypothetical protein | - |
| BV139_RS00555 (BV139_111) | - | 111063..111749 (+) | 687 | WP_005687582.1 | TIGR03747 family integrating conjugative element membrane protein | - |
| BV139_RS00560 (BV139_112) | - | 111910..112230 (+) | 321 | WP_005687583.1 | RAQPRD family integrative conjugative element protein | - |
| BV139_RS00565 | - | 112234..112479 (+) | 246 | WP_005687584.1 | DUF3262 family protein | - |
| BV139_RS00570 (BV139_114) | - | 112499..112900 (+) | 402 | WP_005687585.1 | DUF2976 domain-containing protein | - |
| BV139_RS00575 (BV139_115) | - | 112920..113291 (+) | 372 | WP_005687586.1 | TIGR03750 family conjugal transfer protein | - |
| BV139_RS00580 (BV139_116) | - | 113303..113947 (+) | 645 | WP_005687587.1 | PFL_4703 family integrating conjugative element protein | - |
| BV139_RS00585 (BV139_117) | - | 113947..114816 (+) | 870 | WP_047922050.1 | TIGR03749 family integrating conjugative element protein | - |
| BV139_RS00590 (BV139_118) | - | 114827..116227 (+) | 1401 | WP_005687589.1 | TIGR03752 family integrating conjugative element protein | - |
| BV139_RS00595 (BV139_119) | - | 116237..116644 (+) | 408 | WP_005653518.1 | TIGR03751 family conjugal transfer lipoprotein | - |
| BV139_RS00600 (BV139_120) | - | 116660..119530 (+) | 2871 | WP_005687591.1 | conjugative transfer ATPase | - |
| BV139_RS00605 (BV139_121) | - | 119502..119945 (+) | 444 | WP_005687593.1 | hypothetical protein | - |
| BV139_RS00610 (BV139_122) | - | 119955..120278 (+) | 324 | WP_005667837.1 | hypothetical protein | - |
| BV139_RS00615 (BV139_123) | - | 120287..121780 (+) | 1494 | WP_005687594.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
| BV139_RS00620 (BV139_124) | - | 121836..122165 (-) | 330 | WP_005667844.1 | hypothetical protein | - |
| BV139_RS00625 (BV139_125) | - | 122361..122540 (+) | 180 | WP_005667851.1 | hypothetical protein | - |
| BV139_RS00630 (BV139_126) | - | 122585..122992 (-) | 408 | WP_005667853.1 | hypothetical protein | - |
| BV139_RS00635 (BV139_127) | - | 123008..125008 (-) | 2001 | WP_005687597.1 | integrating conjugative element protein | - |
| BV139_RS00640 (BV139_128) | - | 125023..125964 (-) | 942 | WP_005687598.1 | TIGR03756 family integrating conjugative element protein | - |
| BV139_RS00645 | - | 125961..126398 (-) | 438 | WP_005687600.1 | TIGR03757 family integrating conjugative element protein | - |
| BV139_RS00650 (BV139_129) | - | 126779..127135 (+) | 357 | WP_005653504.1 | hypothetical protein | - |
| BV139_RS00655 (BV139_130) | - | 127220..127453 (+) | 234 | WP_005653503.1 | hypothetical protein | - |
| BV139_RS00660 (BV139_131) | - | 127456..127704 (+) | 249 | WP_005687602.1 | hypothetical protein | - |
| BV139_RS09480 (BV139_132) | - | 127708..127866 (+) | 159 | WP_005687605.1 | hypothetical protein | - |
| BV139_RS00665 (BV139_133) | - | 127995..128900 (+) | 906 | WP_005687607.1 | ArdC family protein | - |
| BV139_RS00670 (BV139_134) | - | 128995..129855 (-) | 861 | WP_000027057.1 | broad-spectrum class A beta-lactamase TEM-1 | - |
| BV139_RS00675 (BV139_135) | - | 130038..130595 (-) | 558 | WP_005687610.1 | recombinase family protein | - |
| BV139_RS00680 | - | 130924..131211 (+) | 288 | WP_032821675.1 | hypothetical protein | - |
| BV139_RS00685 (BV139_137) | - | 131306..131914 (-) | 609 | WP_076090446.1 | hypothetical protein | - |
| BV139_RS00695 (BV139_138) | mobH | 132213..134114 (+) | 1902 | WP_005687617.1 | MobH family relaxase | - |
| BV139_RS00700 (BV139_139) | - | 134175..135017 (+) | 843 | WP_011271867.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 140 a.a. Molecular weight: 15716.54 Da Isoelectric Point: 5.7558
>NTDB_id=219962 BV139_RS00485 WP_005687556.1 98109..98531(+) (ssb) [Haemophilus influenzae strain 6P24H2]
MAGINKVIIVGHLGNDPEMRSMPNGEAVANISVATSEAWTDKNTGERREVTEWHRIVFYRKLAEICGQYLKKGAQVYIEG
RLRTRKWQDQNGQDRYTTEIQGDVMQMLGTRPQSADGANNSQPMPQQDASANAFDDSIPF
MAGINKVIIVGHLGNDPEMRSMPNGEAVANISVATSEAWTDKNTGERREVTEWHRIVFYRKLAEICGQYLKKGAQVYIEG
RLRTRKWQDQNGQDRYTTEIQGDVMQMLGTRPQSADGANNSQPMPQQDASANAFDDSIPF
Nucleotide
Download Length: 423 bp
>NTDB_id=219962 BV139_RS00485 WP_005687556.1 98109..98531(+) (ssb) [Haemophilus influenzae strain 6P24H2]
ATGGCTGGAATTAATAAAGTAATTATCGTGGGACATTTAGGTAATGATCCTGAAATGCGAAGCATGCCGAATGGTGAAGC
AGTTGCAAATATCAGTGTAGCAACTAGCGAAGCTTGGACGGATAAAAACACCGGTGAACGTCGTGAAGTGACTGAATGGC
ATCGAATCGTTTTTTATCGCAAATTAGCTGAAATTTGCGGCCAATATCTCAAGAAAGGAGCGCAAGTTTATATTGAAGGA
CGCTTGCGTACTCGTAAATGGCAAGATCAAAACGGGCAAGATCGTTATACCACGGAAATCCAAGGTGATGTAATGCAAAT
GTTAGGTACTCGCCCTCAAAGTGCAGATGGTGCAAATAATTCTCAGCCAATGCCACAACAAGATGCATCGGCAAATGCTT
TTGATGATTCAATACCATTCTGA
ATGGCTGGAATTAATAAAGTAATTATCGTGGGACATTTAGGTAATGATCCTGAAATGCGAAGCATGCCGAATGGTGAAGC
AGTTGCAAATATCAGTGTAGCAACTAGCGAAGCTTGGACGGATAAAAACACCGGTGAACGTCGTGAAGTGACTGAATGGC
ATCGAATCGTTTTTTATCGCAAATTAGCTGAAATTTGCGGCCAATATCTCAAGAAAGGAGCGCAAGTTTATATTGAAGGA
CGCTTGCGTACTCGTAAATGGCAAGATCAAAACGGGCAAGATCGTTATACCACGGAAATCCAAGGTGATGTAATGCAAAT
GTTAGGTACTCGCCCTCAAAGTGCAGATGGTGCAAATAATTCTCAGCCAATGCCACAACAAGATGCATCGGCAAATGCTT
TTGATGATTCAATACCATTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
56.111 |
100 |
0.721 |
| ssb | Vibrio cholerae strain A1552 |
52.023 |
100 |
0.643 |
| ssb | Neisseria meningitidis MC58 |
59.13 |
82.143 |
0.486 |
| ssb | Neisseria gonorrhoeae MS11 |
59.13 |
82.143 |
0.486 |